PDK2 Antibody - BSA Free

Western Blot: PDK2 Antibody [NBP1-54699] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-54699] - Human Heart Tissue, antibody concentration 5 ug/ml.

Western Blot: PDK2 Antibody [NBP1-54699] - 293T cell lysate, Antibody Titration: 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PDK2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PDK2(pyruvate dehydrogenase kinase, isozyme 2) The peptide sequence was selected from the middle region of PDK2. Peptide sequence ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PDK2 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.2
• lipoamide, kinase isozyme 2, mitochondrial
• PDH kinase 2
• PDHK2
• PDK2
• PDKII
• Pyruvate dehydrogenase kinase isoform 2
• pyruvate dehydrogenase kinase, isoenzyme 2
• pyruvate dehydrogenase kinase, isozyme 2

Background

PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for PDK2 Antibody (NBP1-54699). (Showing 1 - 1 of 1 FAQ).

1. I would like to know which cell line is used for the western blot figures for the PDK2 Antibody (NBP1-54699)
   • For product NBP1-54699 we used whole cell HEK 293 cell lysate for our western blot image.

Bioinformatics

• Gene Symbol: PDK2
• Uniprot:
  • Q15119(Human)