PDGFA Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: PDGFA Antibody [NBP3-05169] - Immunohistochemistry of paraffin-embedded Human esophagus using PDGFA antibody (NBP3-05169) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDGFA Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PDGFA Antibody - Azide and BSA Free (NBP3-05169) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-110 of human PDGFA (NP_002598.4). EEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDGFA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PDGFA Antibody - Azide and BSA Free

• PDGF-1
• PDGF1PDGF A-chain
• PDGF-A
• Platelet-derived growth factor A chain
• platelet-derived growth factor alpha chain
• platelet-derived growth factor alpha isoform 2 preproprotein
• platelet-derived growth factor alpha polypeptidePDGF subunit A
• platelet-derived growth factor subunit A

Background

Platelet-Derived Growth Factor (PDGF) is the major serum mitogen for cells of mesenchymal origin in humans. The biologically active protein is a dimer composed of two related polypeptides designated A and B. The PDGF protein has been implicated both directly as well as indirectly in several pathological states including neoplasia, arthritis, arteriosclerosis and bone marrow sclerosis. This antibody is specific for B form and reacts with PDGF(AB) and PDGF(BB) protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PDGFA