PDE11A Antibody - BSA Free

Immunohistochemistry-Paraffin: PDE11A Antibody [NBP1-85919] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.

Analysis in human prostate tissue.

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Staining of human pancreas shows strong cytoplasmic positivity in endocrine glandular cells and moderate cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDE11A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDE11A Antibody - BSA Free (NBP1-85919) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE11A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PDE11A Protein (NBP1-85919PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDE11A Antibody - BSA Free

• cAMP and cGMP cyclic nucleotide phosphodiesterase 11A
• cAMP and cGMP phosphodiesterase 11A
• cyclic nucleotide phosphodiesterase 11A
• dual 3'-5'-cyclic-AMP and -GMP phosphodiesterase 11A
• EC 3.1.4
• EC 3.1.4.17
• EC 3.1.4.35
• EC 3.1.4.53
• FLJ23693
• MGC133355
• MGC133356
• PDE11A
• PDE11A1
• PDE11A2
• PDE11A3
• phosphodiesterase 11A
• PPNAD2

Background

The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a member of the PDE protein superfamily. Mutations in this gene are a cause of Cushing disease and adrenocortical hyperplasia. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE11A