PDE11A Antibody

Images

 
Western Blot: PDE11A Antibody [NBP1-85919] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: PDE11A Antibody [NBP1-85919] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.
Western Blot: PDE11A Antibody [NBP1-85919] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PDE11A Antibody [NBP1-85919] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE11A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDE11A Protein (NBP1-85919PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE11A Antibody

  • cAMP and cGMP cyclic nucleotide phosphodiesterase 11A
  • cAMP and cGMP phosphodiesterase 11A
  • cyclic nucleotide phosphodiesterase 11A
  • dual 3'-5'-cyclic-AMP and -GMP phosphodiesterase 11A
  • EC 3.1.4
  • EC 3.1.4.17
  • EC 3.1.4.35
  • FLJ23693
  • MGC133355
  • MGC133356
  • PDE11A1
  • PDE11A2
  • PDE11A3
  • phosphodiesterase 11A
  • PPNAD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86280
Species: Hu
Applications: IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46355
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5070
Species: Hu
Applications: WB, Simple Western
NBP1-00641
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PDE11A Antibody (NBP1-85919) (0)

There are no publications for PDE11A Antibody (NBP1-85919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE11A Antibody (NBP1-85919) (0)

There are no reviews for PDE11A Antibody (NBP1-85919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE11A Antibody (NBP1-85919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE11A Products

Bioinformatics Tool for PDE11A Antibody (NBP1-85919)

Discover related pathways, diseases and genes to PDE11A Antibody (NBP1-85919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE11A Antibody (NBP1-85919)

Discover more about diseases related to PDE11A Antibody (NBP1-85919).
 

Pathways for PDE11A Antibody (NBP1-85919)

View related products by pathway.

PTMs for PDE11A Antibody (NBP1-85919)

Learn more about PTMs related to PDE11A Antibody (NBP1-85919).
 

Research Areas for PDE11A Antibody (NBP1-85919)

Find related products by research area.

Blogs on PDE11A

There are no specific blogs for PDE11A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE11A