PDAP1 Antibody (3B10)

Images

 
Western Blot: PDAP1 Antibody (3B10) [H00011333-M05] - Analysis of PDAP1 expression in transfected 293T cell line by PDAP1 monoclonal antibody (M05), clone 3B10. Lane 1: PDAP1 transfected lysate (Predicted MW: 20.6 KDa). ...read more
Sandwich ELISA: PDAP1 Antibody (3B10) [H00011333-M05] - Detection limit for recombinant GST tagged PDAP1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDAP1 Antibody (3B10) Summary

Immunogen
PDAP1 (AAH00684, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
Specificity
PDAP1 - PDGFA associated protein 1 (3B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDAP1 Antibody (3B10)

  • HASPP28
  • PAP1PDGFA-associated protein 1
  • PAP28 kDa heat- and acid-stable phosphoprotein
  • PDGFA associated protein 1
  • PDGF-associated protein

Background

Enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB (By similarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
DSE100
Species: Hu
Applications: ELISA
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB

Publications for PDAP1 Antibody (H00011333-M05) (0)

There are no publications for PDAP1 Antibody (H00011333-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDAP1 Antibody (H00011333-M05) (0)

There are no reviews for PDAP1 Antibody (H00011333-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDAP1 Antibody (H00011333-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDAP1 Products

Diseases for PDAP1 Antibody (H00011333-M05)

Discover more about diseases related to PDAP1 Antibody (H00011333-M05).
 

Pathways for PDAP1 Antibody (H00011333-M05)

View related products by pathway.

PTMs for PDAP1 Antibody (H00011333-M05)

Learn more about PTMs related to PDAP1 Antibody (H00011333-M05).
 

Research Areas for PDAP1 Antibody (H00011333-M05)

Find related products by research area.

Blogs on PDAP1

There are no specific blogs for PDAP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDAP1 Antibody (3B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDAP1
Entrez
Uniprot