PCPTP1 Recombinant Protein Antigen

Images

 
There are currently no images for PCPTP1 Protein (NBP1-84912PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PCPTP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRR.

Source: E. coli

Amino Acid Sequence: YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPRR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84912.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PCPTP1 Recombinant Protein Antigen

  • Ch-1 PTPase
  • ch-1PTPase
  • DKFZp781C1038
  • EC 3.1.3.48
  • ECPTP
  • EC-PTP
  • FLJ34328
  • MGC131968
  • MGC148170
  • NC-PTPCOM1
  • PCPTP1
  • protein tyrosine phosphatase Cr1PTPase
  • protein tyrosine phosphatase, receptor type, R
  • protein-tyrosine phosphatase NC-PTPCOM1
  • Protein-tyrosine phosphatase PCPTP1
  • PTPBR7
  • PTPRQ
  • PTP-SL
  • receptor-type tyrosine-protein phosphatase R
  • R-PTP-R

Background

PCPTP1, also known as Receptor-type tyrosine-protein phosphatase R, has 4 isoforms, a 657 amino acid isoform that is 74 kDa, a 412 amino acid isoform t5hat is 47 k Da, a 451 amino acid isoform that is 51 kDa, and a 545 amino acid isoform that is 61 kDa, expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate, sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. The protein is being studied for its involvement in colorectal cancer, episodic ataxia, ataxia, leukemia, prostatitis, and neuronitis. This protein has also been shown to involve MAPK1, MAPK14, MAPK3, MAPK7, and CDH2 in MAPK signaling pathway, EGFR1 Signaling Pathway, Signal transduction Erk Interactions- Inhibition of Erky, and Epithelial Adherens Junctions pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB7475
Species: Hu, Rt
Applications: WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
NBP2-01340
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
236-EG
Species: Hu
Applications: BA
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB300-202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
AF932
Species: Hu
Applications: ICC, IHC, Simple Western, WB
256-GF
Species: Hu
Applications: BA
NBP1-84912PEP
Species: Hu
Applications: AC

Publications for PCPTP1 Protein (NBP1-84912PEP) (0)

There are no publications for PCPTP1 Protein (NBP1-84912PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCPTP1 Protein (NBP1-84912PEP) (0)

There are no reviews for PCPTP1 Protein (NBP1-84912PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PCPTP1 Protein (NBP1-84912PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCPTP1 Products

Research Areas for PCPTP1 Protein (NBP1-84912PEP)

Find related products by research area.

Blogs on PCPTP1

There are no specific blogs for PCPTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PCPTP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRR