PCNA Antibody (1G7)

Images

 
Western Blot: PCNA Antibody (1G7) [H00005111-M02] - PCNA monoclonal antibody (M02), clone 1G7 Analysis of PCNA expression in Hela.
Immunocytochemistry/ Immunofluorescence: PCNA Antibody (1G7) [H00005111-M02] - Analysis of monoclonal antibody to PCNA on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PCNA Antibody (1G7) [H00005111-M02] - Analysis of PCNA transfected lysate using anti-PCNA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PCNA MaxPab rabbit polyclonal antibody.
Western Blot: PCNA Antibody (1G7) [H00005111-M02] - Analysis of PCNA expression in transfected 293T cell line by PCNA monoclonal antibody (M02), clone 1G7.Lane 1: PCNA transfected lysate(28.8 KDa).Lane 2: ...read more
Sandwich ELISA: PCNA Antibody (1G7) [H00005111-M02] - Detection limit for recombinant GST tagged PCNA is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCNA Antibody (1G7) Summary

Immunogen
PCNA (AAH00491, 1 a.a. - 261 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Localization
Nuclear
Marker
Proliferation Marker
Specificity
PCNA - proliferating cell nuclear antigen
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCNA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00005111-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCNA Antibody (1G7)

  • cyclin
  • DNA polymerase delta auxiliary protein
  • MGC8367
  • proliferating cell nuclear antigen

Background

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF6897
Species: Hu, Mu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for PCNA Antibody (H00005111-M02)(1)

Reviews for PCNA Antibody (H00005111-M02) (0)

There are no reviews for PCNA Antibody (H00005111-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCNA Antibody (H00005111-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCNA Products

Bioinformatics Tool for PCNA Antibody (H00005111-M02)

Discover related pathways, diseases and genes to PCNA Antibody (H00005111-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCNA Antibody (H00005111-M02)

Discover more about diseases related to PCNA Antibody (H00005111-M02).
 

Pathways for PCNA Antibody (H00005111-M02)

View related products by pathway.

PTMs for PCNA Antibody (H00005111-M02)

Learn more about PTMs related to PCNA Antibody (H00005111-M02).
 

Research Areas for PCNA Antibody (H00005111-M02)

Find related products by research area.

Blogs on PCNA.

The dynamic use of a PCNA antibody in fish, porcine and primate species
Proliferating cell nuclear antigen (PCNA) plays a crucial role in nucleic acid metabolism as it pertains to DNA replication and repair.  Most noted for its activation of subunits of DNA polymerase, it has also been found to interact with cell-cycl...  Read full blog post.

The relationship between Ki67 and HIF-1 in cancer
Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life.  First discovered to be located to dividing cells,...  Read full blog post.

Caspase 3 - a Reliable Marker for Index of Apoptosis Induction
Caspase-3 is one of the most important players in apoptosis signaling. It is synthesized as an inactive 32 kDa pro-enzyme and upon direct activation by Caspase-8, -9 or -10, it gets processed into its active forms, the p17-20 and p10-12 subunits. T...  Read full blog post.

PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein)
PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl...  Read full blog post.

PCNA Antibodies: Marking Cell Proliferation & DNA Replication
Proliferating Cell Nuclear Antigen (PCNA), also known as the polymerase delta auxiliary protein, is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It has a large role in cell cycle regulation and...  Read full blog post.

PCNA is a Universal Marker of Proliferating Cells
Proliferating cell nuclear antigen (PCNA) is an evolutionarily well-conserved protein found in all eukaryotic species as well as in Archaea. PCNA was first shown to be involved in DNA replication. However PCNA functions are associated with other vital...  Read full blog post.

Using PCNA as an Antibody Marker
PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCNA Antibody (1G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCNA
Entrez
OMIM
Uniprot