PCM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87196] - Staining of human fallopian tube, liver, ovary and testis using Anti-PCM1 antibody NBP1-87196 (A) shows similar protein distribution across tissues to independent antibody NBP1-87195 (B).

Immunocytochemistry/Immunofluorescence: PCM1 Antibody [NBP1-87196] - Staining of human cell line U-251 MG shows localization to nuclear membrane & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87196] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87196] - Staining of human ovary.

Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87196] - Staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PCM1 Antibody - BSA Free (NBP1-87196) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PCM1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 23943788).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PCM1 Protein (NBP1-87196PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23943788).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCM1 Antibody - BSA Free

• hPCM-1
• pericentriolar material 1 protein
• pericentriolar material 1
• PTC4PCM-1

Background

DNA methylation, or the addition of methyl groups to cytosine bases in the dinucleotide CpG, is imperative to proper development and regulates gene expression. The methylation pattern involves the enzymatic processes of methylation and demethylation. The demethylation enzyme was recently found to be a mammalian protein, which exhibits demethylase activity associated to a methyl-CpG-binding domain (MBD). The enzyme is able to revert methylated cytosine bases to cytosines within the particular dinucleotide sequence mdCpdG by catalyzing the cleaving of the methyl group as methanol. MeCP2 and MBD1 (PCM1) are first found to repress transcription by binding specifically to methylated DNA. MBD2 and MBD4 (also known as MED1) were later found to colocalize with foci of heavily methylated satellite DNA and believed to mediate the biological functions of the methylation signal. Surprisingly, MBD3 does not bind methylated DNA both in vivo and in vitro. MBD1, MBD2, MBD3, and MBD4 are found to be expressed in somatic tissues, but the expression of MBD1 and MBD2 is reduced or absent in embryonic stem cells, which are known to be deficient in MeCP1 activity. MBD4 have homology to bacterial base excision repair DNA N-glycosylases/lyases. In some microsatellite unstable tumors MBD4 is mutated at an exonic polynucleotide tract.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCM1 Antibody (NBP1-87196)(5)

Publications using NBP1-87196

• Hall EA, Kumar D, Prosser SL et al. Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis eLife 2023-02-15 [PMID: 36790165]
• Ronald J. Vagnozzi, Marjorie Maillet, Michelle A. Sargent, Hadi Khalil, Anne Katrine Johansen, Jennifer A. Schwanekamp, Allen J. York, Vincent Huang, Matthias Nahrendorf, Sakthivel Sadayappan, Jeffery D. Molkentin An acute immune response underlies the benefit of cardiac stem cell therapy Nature 2019-11-11 [PMID: 31775156]
• Zhang Y, Seo S, Bhattarai S et al. BBS mutations modify phenotypic expression of CEP290-related ciliopathies. Hum Mol Genet 2014-01-01 [PMID: 23943788] (WB, ICC/IF, Mouse)
• Humbert MC, Weihbrecht K, Searby CC et al. ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting. Proc Natl Acad Sci U S A 2012-11-27 [PMID: 23150559]
• Bergmann O, Zdunek S, Alkass K et al. Identification of cardiomyocyte nuclei and assessment of ploidy for the analysis of cell turnover. Exp Cell Res 2011-01-01 [PMID: 20828558]

Bioinformatics

• Gene Symbol: PCM1