PCID2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCID2. Source: E. coli Amino Acid Sequence: VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PCID2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57674. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PCID2 Recombinant Protein Antigen
Background
PCID2, also known as PCI domain-containing protein 2, belongs to the CSN12 family, is a protein with 4 isoforms ranging from a 376 amino acid that is 43 kDa to a 453 amino acid that is 52 kDa, regulates the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation necessary for B-cell survival. Disease research has shown correlation of this protein with malaria. This protein has been linked to the negative regulation of apoptotic process, regulation of mRNA stability, positive regulation of B cell differentiations, positive regulation of transcription, DNA-dependent and spleen development pathways where it interacts with KPNB1, SMAD2, BRF2, NEK6 and SHFM1 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: BA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for PCID2 Recombinant Protein Antigen (NBP2-57674PEP) (0)
There are no publications for PCID2 Recombinant Protein Antigen (NBP2-57674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCID2 Recombinant Protein Antigen (NBP2-57674PEP) (0)
There are no reviews for PCID2 Recombinant Protein Antigen (NBP2-57674PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PCID2 Recombinant Protein Antigen (NBP2-57674PEP) (0)
Additional PCID2 Products
Research Areas for PCID2 Recombinant Protein Antigen (NBP2-57674PEP)
Find related products by research area.
|
Blogs on PCID2