PCCA Antibody

Images

 
Western Blot: PCCA Antibody [NBP2-13736] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: PCCA Antibody [NBP2-13736] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCCA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGV RVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PCCA Protein (NBP2-13736PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCCA Antibody

  • EC 6.4.1
  • EC 6.4.1.3
  • pccA complementation group
  • PCCase alpha subunit
  • PCCase subunit alpha
  • propanoyl-CoA:carbon dioxide ligase alpha subunit
  • Propanoyl-CoA:carbon dioxide ligase subunit alpha
  • propionyl CoA carboxylase, alpha polypeptide
  • propionyl Coenzyme A carboxylase, alpha polypeptide
  • propionyl-CoA carboxylase alpha chain, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85886
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85179
Species: Hu
Applications: IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCCA Antibody (NBP2-13736) (0)

There are no publications for PCCA Antibody (NBP2-13736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCCA Antibody (NBP2-13736) (0)

There are no reviews for PCCA Antibody (NBP2-13736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCCA Antibody (NBP2-13736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCCA Products

Bioinformatics Tool for PCCA Antibody (NBP2-13736)

Discover related pathways, diseases and genes to PCCA Antibody (NBP2-13736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCCA Antibody (NBP2-13736)

Discover more about diseases related to PCCA Antibody (NBP2-13736).
 

Pathways for PCCA Antibody (NBP2-13736)

View related products by pathway.

PTMs for PCCA Antibody (NBP2-13736)

Learn more about PTMs related to PCCA Antibody (NBP2-13736).

Blogs on PCCA

There are no specific blogs for PCCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCCA