PCCB Antibody


Western Blot: PCCB Antibody [NBP1-85886] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human skin shows only weak cytoplasmic positivity in a subset of epidermal cells.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining in human liver and skin tissues. Corresponding PCCB RNA-seq data are presented for the same tissues.
Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PCCB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL
Specificity of human PCCB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PCCB Protein (NBP1-85886PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PCCB Antibody

  • beta polypeptide
  • mitochondrial
  • propionyl CoA carboxylase, beta polypeptide


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for PCCB Antibody (NBP1-85886) (0)

There are no publications for PCCB Antibody (NBP1-85886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCCB Antibody (NBP1-85886) (0)

There are no reviews for PCCB Antibody (NBP1-85886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCCB Antibody (NBP1-85886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCCB Products

Bioinformatics Tool for PCCB Antibody (NBP1-85886)

Discover related pathways, diseases and genes to PCCB Antibody (NBP1-85886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCCB Antibody (NBP1-85886)

Discover more about diseases related to PCCB Antibody (NBP1-85886).

Pathways for PCCB Antibody (NBP1-85886)

View related products by pathway.

PTMs for PCCB Antibody (NBP1-85886)

Learn more about PTMs related to PCCB Antibody (NBP1-85886).

Research Areas for PCCB Antibody (NBP1-85886)

Find related products by research area.

Blogs on PCCB

There are no specific blogs for PCCB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCCB Antibody and receive a gift card or discount.


Gene Symbol PCCB