PCCB Antibody

Images

 
Western Blot: PCCB Antibody [NBP1-85886] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCCB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCCB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PCCB Protein (NBP1-85886PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCCB Antibody

  • beta polypeptide
  • mitochondrial
  • propionyl CoA carboxylase, beta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005095-B01P
Species: Hu
Applications: WB
NBP1-85179
Species: Hu
Applications: IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-33582
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-41102
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
NBP1-85886
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for PCCB Antibody (NBP1-85886) (0)

There are no publications for PCCB Antibody (NBP1-85886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCCB Antibody (NBP1-85886) (0)

There are no reviews for PCCB Antibody (NBP1-85886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCCB Antibody (NBP1-85886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCCB Products

Bioinformatics Tool for PCCB Antibody (NBP1-85886)

Discover related pathways, diseases and genes to PCCB Antibody (NBP1-85886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCCB Antibody (NBP1-85886)

Discover more about diseases related to PCCB Antibody (NBP1-85886).
 

Pathways for PCCB Antibody (NBP1-85886)

View related products by pathway.

PTMs for PCCB Antibody (NBP1-85886)

Learn more about PTMs related to PCCB Antibody (NBP1-85886).
 

Research Areas for PCCB Antibody (NBP1-85886)

Find related products by research area.

Blogs on PCCB

There are no specific blogs for PCCB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCCB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCCB
Entrez
Uniprot