Recombinant Human PCBP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCBP2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 174 - 283 of Human PCBP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
PCBP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCBP2 Protein

  • alpha-CP2
  • Heterogeneous nuclear ribonucleoprotein E2
  • heterogenous nuclear ribonucleoprotein E2
  • hnRNP E2
  • hnRNP-E2
  • HNRPE2
  • MGC110998
  • poly(rC) binding protein 2
  • poly(rC)-binding protein 2

Background

PCBP2 - poly(rC) binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46336
Species: Hu
Applications: WB, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP2-49154
Species: Hu
Applications: IHC
NB110-40424
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF4538
Species: Hu, Mu, Rt
Applications: WB
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00005094-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PCBP2 Partial Recombinant Protein (H00005094-Q01) (0)

There are no publications for PCBP2 Partial Recombinant Protein (H00005094-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCBP2 Partial Recombinant Protein (H00005094-Q01) (0)

There are no reviews for PCBP2 Partial Recombinant Protein (H00005094-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCBP2 Partial Recombinant Protein (H00005094-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCBP2 Products

Bioinformatics Tool for PCBP2 Partial Recombinant Protein (H00005094-Q01)

Discover related pathways, diseases and genes to PCBP2 Partial Recombinant Protein (H00005094-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCBP2 Partial Recombinant Protein (H00005094-Q01)

Discover more about diseases related to PCBP2 Partial Recombinant Protein (H00005094-Q01).
 

Pathways for PCBP2 Partial Recombinant Protein (H00005094-Q01)

View related products by pathway.

PTMs for PCBP2 Partial Recombinant Protein (H00005094-Q01)

Learn more about PTMs related to PCBP2 Partial Recombinant Protein (H00005094-Q01).

Blogs on PCBP2

There are no specific blogs for PCBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCBP2 Antibody (5F12)
H00005094-M07

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCBP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBP2