PCBD1 Antibody (1G11-H5)

Images

 
Western Blot: PCBD1 Antibody (1G11-H5) [H00005092-M01] - PCBD1 monoclonal antibody (M01), clone 1G11-H5 Analysis of PCBD1 expression in C32.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G11-H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCBD1 Antibody (1G11-H5) Summary

Immunogen
PCBD1 (AAH06324, 1 a.a. - 104 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Specificity
PCBD1 - 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCBD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCBD1 Antibody (1G11-H5)

  • 4-alpha-hydroxy-tetrahydropterin dehydratase
  • DCoH
  • DCOHpterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1)
  • Dimerization cofactor of hepatocyte nuclear factor 1-alpha
  • Dimerization cofactor of HNF1
  • PCBDdimerizing cofactor for HNF1,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1)
  • PCDEC 4.2.1.96
  • Phenylalanine hydroxylase-stimulating protein
  • PHS
  • Pterin carbinolamine dehydratase
  • pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha
  • pterin-4-alpha-carbinolamine dehydratase

Background

This gene encodes pterin-4 alpha-carbinolamine dehydratase, an enzyme involved in phenylalanine hydroxylation. A deficiency of this enzyme leads to hyperphenylalaninemia. The enzyme regulates the homodimerization of the transcription factor hepatocyte nuclear factor 1 (HNF1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00005092-M01
Species: Hu
Applications: WB, ELISA

Publications for PCBD1 Antibody (H00005092-M01) (0)

There are no publications for PCBD1 Antibody (H00005092-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCBD1 Antibody (H00005092-M01) (0)

There are no reviews for PCBD1 Antibody (H00005092-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCBD1 Antibody (H00005092-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCBD1 Products

Bioinformatics Tool for PCBD1 Antibody (H00005092-M01)

Discover related pathways, diseases and genes to PCBD1 Antibody (H00005092-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PCBD1

There are no specific blogs for PCBD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCBD1 Antibody (1G11-H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBD1
Entrez
OMIM
Uniprot