![Immunocytochemistry/Immunofluorescence: PCAF Antibody [NBP2-58285] - Staining of human cell line U-2 OS shows localization to nucleus.](http://images.novusbio.com/fullsize2/PCAF Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58285-img0001.jpg "Immunocytochemistry/Immunofluorescence: PCAF Antibody [NBP2-58285] - Staining of human cell line U-2 OS shows localization to nucleus.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY |
| Specificity | Specificity of human PCAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KAT2B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for PCAF Antibody (NBP2-58285)Discover more about diseases related to PCAF Antibody (NBP2-58285).
| Pathways for PCAF Antibody (NBP2-58285)View related products by pathway.
|
PTMs for PCAF Antibody (NBP2-58285)Learn more about PTMs related to PCAF Antibody (NBP2-58285).
| Research Areas for PCAF Antibody (NBP2-58285)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KAT2B |
![Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Immunocytochemistry-Immunofluorescence-NB100-616-img0005.jpg)
![Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Western-Blot-NB100-616-img0002.jpg)
![Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.](http://images.novusbio.com/images2/KAT3B-p300 Antibody (RW105)-Flow Cytometry-NB100-616-img0006.jpg)
![Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/images2/CBP-KAT3A-Antibody-Western-Blot-NB100-381-img0032.jpg)
![Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/CBP-KAT3A-Antibody-Immunoprecipitation-NB100-381-img0031.jpg)
![Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.](http://images.novusbio.com/images2/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody](http://images.novusbio.com/images2/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody](http://images.novusbio.com/images2/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.](http://images.novusbio.com/images2/MCG10-Antibody-Western-Blot-NBP1-76729-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.](http://images.novusbio.com/images2/MCG10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76729-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.](http://images.novusbio.com/images2/MCG10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76729-img0003.jpg)
![Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/KAT2A-GCN5 Antibody-Western Blot-NBP2-17017-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: KAT2A/GCN5 Antibody [NBP2-17017] - Analysis of paraformaldehyde-fixed MCF-7, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/KAT2A-GCN5 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-17017-img0003.jpg)
![Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: IMR32 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/KAT2A-GCN5 Antibody-Western Blot-NBP2-17017-img0001.jpg)
![SDS-Page: Recombinant Human OCA2 Protein [H00004948-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/images/qc_test-H00004948-Q01-1.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0013.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).](http://images.novusbio.com/images2/p21-CIP1-CDKN1A-Antibody-(WA-1-(HJ21))-Immunohistochemistry-Paraffin-NBP2-29463-img0001.jpg)
![Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/images2/HDAC1-Antibody-Knockout-Validated-NB100-56340-img0007.jpg)
![Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.](http://images.novusbio.com/images2/HDAC1-Antibody-Western-Blot-NB100-56340-img0002.jpg)
![Immunohistochemistry-Paraffin: HDAC1 Antibody [NB100-56340] - Human testis using HDAC1 antibody at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.](http://images.novusbio.com/images2/HDAC1-Antibody-Immunohistochemistry-Paraffin-NB100-56340-img0005.jpg)
![Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.](http://images.novusbio.com/images/HIST1H4F Overexpression Lysate (Adult Normal)-Western Blot-NBP2-07996-img0001.jpg)
![Western Blot: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis using HIST2H4A(20Me) mouse mAb against THP-1 (1) cell lysate.](http://images.novusbio.com/images2/H4-n-Antibody-(3E7H2)-Western-Blot-NBP2-52486-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of HeLa cells using HIST2H4A(20Me) mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.](http://images.novusbio.com/images2/H4-n-Antibody-(3E7H2)-Immunohistochemistry-NBP2-52486-img0003.jpg)
![Immunohistochemistry-Paraffin: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of paraffin-embedded stomach cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.](http://images.novusbio.com/images2/H4-n-Antibody-(3E7H2)-Immunohistochemistry-Paraffin-NBP2-52486-img0005.jpg)
![Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.](http://images.novusbio.com/images2/SRC1-Antibody-(1135-H4)-Western-Blot-NB200-310-img0003.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0012.jpg)
![Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunohistochemistry-Paraffin-NBP1-30141-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunocytochemistry-Immunofluorescence-NBP1-30141-img0011.jpg)
![Western Blot: CREB Antibody [NBP1-90364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/images2/CREB-Antibody-Western-Blot-NBP1-90364-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: CREB Antibody [NBP1-90364] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/CREB Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90364-img0007.jpg)
![Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364] - Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/CREB-Antibody-Immunohistochemistry-Paraffin-NBP1-90364-img0002.jpg)
![Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/HDAC9-Antibody-Western-Blot-NBP2-03993-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")