Parkin Antibody (1H4)

Images

 
Western Blot: Parkin Antibody (1H4) [H00005071-M01] - PARK2 monoclonal antibody (M01), clone 1H4 Analysis of PARK2 expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: Parkin Antibody (1H4) [H00005071-M01] - Analysis of monoclonal antibody to PARK2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Parkin Antibody (1H4) [H00005071-M01] - Detection limit for recombinant GST tagged PARK2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Parkin Antibody (1H4) Summary

Immunogen
PARK2 (AAH22014, 288 a.a. - 387 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
Specificity
PARK2 - Parkinson disease (autosomal recessive, juvenile) 2, parkin
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PARK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Control
Parkin Lysate (NBP2-64849)
Reviewed Applications
Read 2 Reviews rated 3.5
using
H00005071-M01 in the following applications:

Publications
Read Publications using H00005071-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Parkin Antibody (1H4)

  • AR-JP
  • E3 ubiquitin ligase
  • E3 ubiquitin-protein ligase parkin
  • EC 6.3.2.-
  • LPRS2
  • PARK2
  • parkin 2
  • Parkin
  • Parkinson disease protein 2
  • Parkinson juvenile disease protein 2
  • parkinson protein 2, E3 ubiquitin protein ligase (parkin)
  • PDJ
  • PDJjuvenile) 2, parkin
  • PRKN

Background

The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
BC100-494
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, In vitro
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-03274
Species: Hu, Mu, Rt, Ch, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-55955
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Parkin Antibody (H00005071-M01)(3)

Reviews for Parkin Antibody (H00005071-M01) (2) 3.52

Average Rating: 3.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using H00005071-M01:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 Parkin H00005071-M01
Enlarge
reviewed by:
Francesca Pacifici
Mouse 09/26/2017
View

Summary

Sample TestedMouse skeletal muscle homogenate
SpeciesMouse
LotH6011-1H4

Comments

CommentsWestern Blot: Parkin Antibody (1H4) [H00005071-M01] - Western blot analysisi was performed in mouse skeletal muscle proteins, separated by 4-12% SDS-PAGE. Proteins were transferred on nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. Anti Parkin antibody was used 1:1000
Simple Western Parkin H00005071-M01
Enlarge
reviewed by:
Anonymous
Simple Western Human 08/22/2016
View

Summary

ApplicationSimple Western
Sample TestedSVG-A cells (different total protein concentrations of the mitochondria-enriched fraction versus whole-cell lysate)
SpeciesHuman

Blocking

Blocking Details-

Details

Detection NotesWes platform

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Parkin Antibody (H00005071-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Parkin Antibody (H00005071-M01)

Discover related pathways, diseases and genes to Parkin Antibody (H00005071-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Parkin Antibody (H00005071-M01)

Discover more about diseases related to Parkin Antibody (H00005071-M01).
 

Pathways for Parkin Antibody (H00005071-M01)

View related products by pathway.

PTMs for Parkin Antibody (H00005071-M01)

Learn more about PTMs related to Parkin Antibody (H00005071-M01).
 

Research Areas for Parkin Antibody (H00005071-M01)

Find related products by research area.

Blogs on Parkin.

There's an autophagy for that!
By Christina Towers, PhDA critical mechanism that cells use to generate nutrients and fuel metabolism is through a process called autophagy.  This process is complex and involves over 20 different proteins, most of which are highly conserved acro...  Read full blog post.

The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1,...  Read full blog post.

Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease
Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit...  Read full blog post.

PINK1 - performing mitochondrial quality control and protecting against Parkinson’s disease
PTEN-induced putative kinase 1 (PINK1) is a serine/threonine kinase with important functions in mitochondrial quality control. Together with the Parkin protein, PINK1 is able to regulate the selective degradation of damaged mitochondria through aut...  Read full blog post.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

PINK1: Promoting Organelle Stability and Preventing Parkinson's disease
PINK1 is a protein serine/threonine kinase (PTK) that protects the organelles from cellular stress and controls selective autophagy to clear damage. Exner, et al. were among the first to report that PINK1 deficiency in humans was linked to autosomal r...  Read full blog post.

Novus Antibodies Highlighted in Parkinson's Disease Research
Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide (www.parkinsons.org). The prevalence of Parkinson's disease is expected to grow considerably as the average age o...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3.5
5
0
4
1
3
1
2
0
1
0

Francesca Pacifici
09/26/2017
Application:
Species: Mouse

Anonymous
08/22/2016
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol PARK2
Entrez
OMIM
Uniprot