PARG Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PARG Antibody [NBP1-89450] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PARG Antibody [NBP1-89450] - Staining in human testis and pancreas tissues using anti-PARG antibody. Corresponding PARG RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PARG Antibody [NBP1-89450] - Staining of human testis shows high expression.

Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PARG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PARG Antibody - BSA Free (NBP1-89450) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-PARG Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAA
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PARG Protein (NBP1-89450PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30459355).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PARG Antibody - BSA Free

• EC 3.2.1.143
• FLJ54459
• FLJ60257
• FLJ60456
• PARG
• PARG99
• poly (ADP-ribose) glycohydrolase
• poly(ADP-ribose) glycohydrolase 60 kDa isoform
• poly(ADP-ribose) glycohydrolase

Background

Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARG Antibody (NBP1-89450)(1)

Publication using NBP1-89450

• Marques M, Jangal M, Wang LC, Kazanets A. Oncogenic activity of poly (ADP-ribose) glycohydrolase. Oncogene. 1905-07-10 [PMID: 30459355] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: PARG