PARG Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PARG Antibody [NBP1-89450] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: PARG Antibody [NBP1-89450] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PARG Protein (NBP1-89450PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARG Antibody

  • EC 3.2.1.143
  • FLJ54459
  • FLJ60257
  • FLJ60456
  • PARG
  • PARG99
  • poly (ADP-ribose) glycohydrolase
  • poly(ADP-ribose) glycohydrolase 60 kDa isoform
  • poly(ADP-ribose) glycohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-185
Species: Hu
Applications: WB
NBP1-88835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00055684-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35006
Species: Hu
NBP1-89450
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PARG Antibody (NBP1-89450) (0)

There are no publications for PARG Antibody (NBP1-89450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARG Antibody (NBP1-89450) (0)

There are no reviews for PARG Antibody (NBP1-89450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PARG Antibody (NBP1-89450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARG Products

Bioinformatics Tool for PARG Antibody (NBP1-89450)

Discover related pathways, diseases and genes to PARG Antibody (NBP1-89450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARG Antibody (NBP1-89450)

Discover more about diseases related to PARG Antibody (NBP1-89450).
 

Pathways for PARG Antibody (NBP1-89450)

View related products by pathway.

PTMs for PARG Antibody (NBP1-89450)

Learn more about PTMs related to PARG Antibody (NBP1-89450).

Blogs on PARG

There are no specific blogs for PARG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARG
Entrez