PARD6B Antibody

Immunocytochemistry/Immunofluorescence: PARD6B Antibody [NBP1-87337] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ChIP, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PARD6B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARD6B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: Use in ChIP reported in scientific literature (PMID:33242849). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PARD6B Protein (NBP1-87337PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PARD6B Antibody

• par-6 (partitioning defective 6, C.elegans) homolog beta
• PAR-6 beta
• par-6 partitioning defective 6 homolog beta (C. elegans)
• PAR6B
• PAR-6B
• partitioning defective 6 homolog beta

Background

The PARD6B gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell pol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARD6B Antibody (NBP1-87337)(4)

Publications using NBP1-87337

• Das A, Adhikary S, Chowdhury AR Et al. Leveraging Substrate Stiffness to Promote Stem Cell Asymmetric Division via Mechanotransduction-Polarity Protein Axis and Its Bayesian Regression Analysis Rejuvenation Res 2022-03-22 [PMID: 35316074] (ICC/IF)
  
  Details:
  Citation using the Texas Red version of this antibody.
• Das A, Adhikary S, Roy Chowdhury A, Barui A Substrate dependent control on the chiral orientation of mesenchymal stem cells: image-based quantitative profiling Exp Cell Res 2020-11-23 [PMID: 33242849] (ChIP, Human)
• Frum T, Ralston A. Visualizing HIPPO Signaling Components in Mouse Early Embryonic Development Methods Mol. Biol. 2019-12-20 [PMID: 30565145] (IHC, Mouse)
• Frum T, Murphy TM, Ralston A. HIPPO signaling resolves embryonic cell fate conflicts during establishment of pluripotency in vivo Elife 2018-12-11 [PMID: 30526858] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: PARD6B