PARD3B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PARD3B Antibody [NBP1-89114] - Staining of human cell line CACO-2 shows localization to cell junctions.
Immunohistochemistry-Paraffin: PARD3B Antibody [NBP1-89114] - Staining of human skin shows strong cytoplasmic positivity in basal cells of the squamous epithelium.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARD3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ARREGFPLYEDDEGRARPSEYDLLWVPGRGPDGNAHNLRFEGMERQYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARD3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PARD3B Protein (NBP1-89114PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARD3B Antibody

  • ALS2CR19
  • amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein
  • MGC16131
  • par-3 partitioning defective 3 homolog B (C. elegans)
  • PAR3B
  • PAR3beta
  • PAR3-beta
  • PAR3-L protein
  • PAR3L
  • Par3Lb
  • PAR3LC
  • partitioning defective 3 homolog B
  • Partitioning defective 3-like protein
  • partitioning-defective 3-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-56902
Species: Hu
Applications: WB, ICC/IF
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90980
Species: Hu
Applications: IHC, IHC-P
NBP1-03020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP1-89114
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PARD3B Antibody (NBP1-89114) (0)

There are no publications for PARD3B Antibody (NBP1-89114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD3B Antibody (NBP1-89114) (0)

There are no reviews for PARD3B Antibody (NBP1-89114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PARD3B Antibody (NBP1-89114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARD3B Products

Bioinformatics Tool for PARD3B Antibody (NBP1-89114)

Discover related pathways, diseases and genes to PARD3B Antibody (NBP1-89114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD3B Antibody (NBP1-89114)

Discover more about diseases related to PARD3B Antibody (NBP1-89114).
 

Pathways for PARD3B Antibody (NBP1-89114)

View related products by pathway.

PTMs for PARD3B Antibody (NBP1-89114)

Learn more about PTMs related to PARD3B Antibody (NBP1-89114).
 

Research Areas for PARD3B Antibody (NBP1-89114)

Find related products by research area.

Blogs on PARD3B

There are no specific blogs for PARD3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARD3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD3B