PARD3/Par3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARD3/Par3. Peptide sequence LEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PARD3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
110 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PARD3/Par3 Antibody - BSA Free
Background
PARD3 is an adaptor protein involved in asymmetrical cell division and cell polarization processes. PARD3 seems to play a central role in the formation of epithelial tight junctions. PARD3 may affect the quality of hair pigmentation, and act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone (2-3). PARD3 may also play a role in neuroendocrine aspects of melanocortin action, and have a functional role in regulating lipid metabolism in adipocytes (4-5). Recent studies have suggested PARD3 (Par-3) is essential in the formation of myelin sheaths on neuronal axons.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ch, Hu, Mu
Applications: ICC/IF, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB, IHC
Publications for PARD3/Par3 Antibody (NBP3-10559) (0)
There are no publications for PARD3/Par3 Antibody (NBP3-10559).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PARD3/Par3 Antibody (NBP3-10559) (0)
There are no reviews for PARD3/Par3 Antibody (NBP3-10559).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PARD3/Par3 Antibody (NBP3-10559) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PARD3/Par3 Products
Research Areas for PARD3/Par3 Antibody (NBP3-10559)
Find related products by research area.
|
Blogs on PARD3/Par3