PAP2 Antibody


Immunocytochemistry/ Immunofluorescence: PAP2 Antibody [NBP1-91086] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and centrosome.
Immunohistochemistry-Paraffin: PAP2 Antibody [NBP1-91086] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: PAP2 Antibody [NBP1-91086] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & centrosome.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PAP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAP2 Protein (NBP1-91086PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PAP2 Antibody

  • lipid phosphate phosphatase-related protein type 5
  • phosphatidic acid phosphatase 2d
  • phosphatidic acid phosphatase type 2
  • PRG-5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PAP2 Antibody (NBP1-91086) (0)

There are no publications for PAP2 Antibody (NBP1-91086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAP2 Antibody (NBP1-91086) (0)

There are no reviews for PAP2 Antibody (NBP1-91086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PAP2 Antibody (NBP1-91086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAP2 Products

PAP2 NBP1-91086

Bioinformatics Tool for PAP2 Antibody (NBP1-91086)

Discover related pathways, diseases and genes to PAP2 Antibody (NBP1-91086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PAP2

There are no specific blogs for PAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAP2 Antibody and receive a gift card or discount.


Gene Symbol LPPR5