PANP/PILR alpha associated neural protein Antibody

Images

 
Western Blot: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunocytochemistry/ Immunofluorescence: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in neurons.
Immunohistochemistry: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining shows distinct cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PANP/PILR alpha associated neural protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIANP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PANP/PILR alpha associated neural protein Recombinant Protein Antigen (NBP1-90541PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PANP/PILR alpha associated neural protein Antibody

  • C12orf53
  • chromosome 12 open reading frame 53
  • PANP
  • PIANP
  • PILR alpha associated neural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
DDX0230P-100
Species: Hu
Applications: WB, Flow, IP
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2690
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-80775
Species: Hu
Applications: IHC, IHC-P

Publications for PANP/PILR alpha associated neural protein Antibody (NBP1-90541) (0)

There are no publications for PANP/PILR alpha associated neural protein Antibody (NBP1-90541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PANP/PILR alpha associated neural protein Antibody (NBP1-90541) (0)

There are no reviews for PANP/PILR alpha associated neural protein Antibody (NBP1-90541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PANP/PILR alpha associated neural protein Antibody (NBP1-90541). (Showing 1 - 1 of 1 FAQ).

  1. I plan to use NBP1-90541 for IHC-frozen, do you have any additional information for this?
    • The product of interest, NBP1-90541 (PANP/PILR alpha associated neural protein Antibody), has never been validated in IHC-Fr, only IHC-P. In our experiences, the antibodies which can be used in IHC-P can be applied to IHC-Fr in some cases, provided some optimization (e.g. changing dilutions, etc) is performed. The only real wet-bench tests by you can determine whether NBP1-90541 is suitable to IHC-Fr. If indeed you use NBP1-90541 in IHC-Fr, you will be automatically qualified for our Innovator's Reward Program. Since this antibody has never been tested in IHC-Fr, our specialists will not know whether it will work in the application or how to make it work (i.e. no special IHC-Fr protocol for NBP1-90541). However our general IHC-Fr may be useful: Protocol. Checking the troubleshooting guide may help too: Troubleshooting Guide.

Secondary Antibodies

 

Isotype Controls

Additional PANP/PILR alpha associated neural protein Products

Bioinformatics Tool for PANP/PILR alpha associated neural protein Antibody (NBP1-90541)

Discover related pathways, diseases and genes to PANP/PILR alpha associated neural protein Antibody (NBP1-90541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PANP/PILR alpha associated neural protein

There are no specific blogs for PANP/PILR alpha associated neural protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PANP/PILR alpha associated neural protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIANP
Entrez