PANP/PILR alpha associated neural protein Antibody - BSA Free

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Analysis in human cerebral cortex and liver tissues. Corresponding PIANP RNA-seq data are presented for the same tissues.

Western Blot: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Analysis in control (vector only transfected HEK293T lysate) and PIANP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PANP/PILR alpha associated neural protein Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIANP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PANP/PILR alpha associated neural protein Recombinant Protein Antigen (NBP1-90541PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PANP/PILR alpha associated neural protein Antibody - BSA Free

• C12orf53
• chromosome 12 open reading frame 53
• PANP
• PIANP
• PILR alpha associated neural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PANP/PILR alpha associated neural protein Antibody (NBP1-90541)(2)

Publications using NBP1-90541

• Abou Nader N, Blais �, St-Jean G et al. Effect of Inactivation of Mst1 and Mst2 in the Mouse Adrenal Cortex Journal of the Endocrine Society 2022-11-17 [PMID: 36405866]
• MC Dinamarca, A Raveh, A Schneider, T Fritzius, S Früh, PD Rem, M Stawarski, T Lalanne, R Turecek, M Choo, V Besseyrias, W Bildl, D Bentrop, M Staufenbie, M Gassmann, B Fakler, J Schwenk, B Bettler Complex formation of APP with GABAB receptors links axonal trafficking to amyloidogenic processing Nat Commun, 2019-03-22;10(1):1331. 2019-03-22 [PMID: 30902970]

FAQs for PANP/PILR alpha associated neural protein Antibody (NBP1-90541). (Showing 1 - 1 of 1 FAQs).

1. I plan to use NBP1-90541 for IHC-frozen, do you have any additional information for this?
   • The product of interest, NBP1-90541 (PANP/PILR alpha associated neural protein Antibody), has never been validated in IHC-Fr, only IHC-P. In our experiences, the antibodies which can be used in IHC-P can be applied to IHC-Fr in some cases, provided some optimization (e.g. changing dilutions, etc) is performed. The only real wet-bench tests by you can determine whether NBP1-90541 is suitable to IHC-Fr. If indeed you use NBP1-90541 in IHC-Fr, you will be automatically qualified for our Innovator's Reward Program. Since this antibody has never been tested in IHC-Fr, our specialists will not know whether it will work in the application or how to make it work (i.e. no special IHC-Fr protocol for NBP1-90541). However our general IHC-Fr may be useful: Protocol. Checking the troubleshooting guide may help too: Troubleshooting Guide.

Bioinformatics

• Gene Symbol: PIANP