PAN3 Antibody

Images

 
Immunohistochemistry-Paraffin: PAN3 Antibody [NBP1-89438] - Staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
PAN3 Protein (NBP1-89438PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAN3 Antibody

  • hPan3
  • PAB-dependent poly(A)-specific ribonuclease subunit 3
  • PABP1-dependent poly A-specific ribonuclease subunit PAN3
  • PABP-dependent poly(A) nuclease 3
  • PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • TS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03667
Species: Hu, Rt
Applications: WB, Flow
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00009924-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-368
Species: Hu
Applications: WB
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP

Publications for PAN3 Antibody (NBP1-89438) (0)

There are no publications for PAN3 Antibody (NBP1-89438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAN3 Antibody (NBP1-89438) (0)

There are no reviews for PAN3 Antibody (NBP1-89438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PAN3 Antibody (NBP1-89438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAN3 Products

Bioinformatics Tool for PAN3 Antibody (NBP1-89438)

Discover related pathways, diseases and genes to PAN3 Antibody (NBP1-89438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAN3 Antibody (NBP1-89438)

Discover more about diseases related to PAN3 Antibody (NBP1-89438).
 

Pathways for PAN3 Antibody (NBP1-89438)

View related products by pathway.

PTMs for PAN3 Antibody (NBP1-89438)

Learn more about PTMs related to PAN3 Antibody (NBP1-89438).
 

Research Areas for PAN3 Antibody (NBP1-89438)

Find related products by research area.

Blogs on PAN3

There are no specific blogs for PAN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAN3