Pallidin Antibody


Western Blot: Pallidin Antibody [NBP1-87357] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: Pallidin Antibody [NBP1-87357] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Pallidin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
Specificity of human Pallidin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pallidin Protein (NBP1-87357PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Pallidin Antibody

  • pallid (mouse) homolog, pallidin
  • Pallid protein homolog
  • pallidin homolog (mouse)
  • pallidin
  • PAsyntaxin 13 binding protein 1
  • syntaxin 13-interacting protein pallid
  • Syntaxin 13-interacting protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ba
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, IA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P

Publications for Pallidin Antibody (NBP1-87357) (0)

There are no publications for Pallidin Antibody (NBP1-87357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pallidin Antibody (NBP1-87357) (0)

There are no reviews for Pallidin Antibody (NBP1-87357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pallidin Antibody (NBP1-87357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Pallidin Products

Bioinformatics Tool for Pallidin Antibody (NBP1-87357)

Discover related pathways, diseases and genes to Pallidin Antibody (NBP1-87357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Pallidin Antibody (NBP1-87357)

Find related products by research area.

Blogs on Pallidin

There are no specific blogs for Pallidin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Pallidin Antibody and receive a gift card or discount.


Gene Symbol BLOC1S6