PAK4 Antibody - BSA Free

Western Blot: PAK4 Antibody [NBP2-58833] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PAK4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: PAK4 Antibody [NBP2-58833] - Staining of human cell line MCF7 shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.

Western Blot: PAK4 Antibody [NBP2-58833] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Western Blot: PAK4 Antibody [NBP2-58833] - Analysis using Anti-PAK4 antibody NBP2-58833 (A) shows similar pattern to independent antibody NBP2-56634 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAK4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PAK4 Antibody - BSA Free (NBP2-58833) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAGHSEAGGGSGDRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAK4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PAK4 Recombinant Protein Antigen (NBP2-58833PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PAK4 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• KIAA1142
• p21 protein (Cdc42/Rac)-activated kinase 4
• p21(CDKN1A)-activated kinase 4
• p21-activated kinase 4
• PAK4
• PAK-4
• protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
• serine/threonine-protein kinase PAK 4

Background

p21-activated kinases (PAKs) belong to the family of serine/threonine kinases involved in the control of various cellular processes, including the cell cycle, dynamics of the cytoskeleton, apoptosis, oncogenic transformation, and transcription. All PAK family members are characterized by the presence of p21-binding domain. p21-activated kinases are regulated by the small GTP-binding proteins Rac and Cdc42, and lipids, which stimulate autophosphorylation and phosphorylation of exogenous substrates. Serine (Ser-474) is the likely autophosphorylation site in the kinase domain of PAK4 in vivo. Phosphospecific antibodies directed against serine 474 detect activated PAK4 on the Golgi membrane when PAK4 is co-expressed with activated Cdc42. Current data strongly implicates PAK-4 in oncogenesis. PAK4 is frequently overexpressed in human tumor cell lines of various tissue origins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAK4