PAK1 Antibody (4D1)

Images

 
Western Blot: PAK1 Antibody (4D1) [H00005058-M02] - Analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody (M02), clone 4D1.Lane 1: PAK1 transfected lysate (Predicted MW: 49.6 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: PAK1 Antibody (4D1) [H00005058-M02] - Analysis of monoclonal antibody to PAK1 on HeLa cell. Antibody concentration 35 ug/ml.
Immunohistochemistry-Paraffin: PAK1 Antibody (4D1) [H00005058-M02] - Analysis of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml.
Western Blot: PAK1 Antibody (4D1) [H00005058-M02] - Western Blot analysis of PAK1 expression in HeLa NE ( Cat # L013V3 ).
Immunoprecipitation: PAK1 Antibody (4D1) [H00005058-M02] - Analysis of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody.
Sandwich ELISA: PAK1 Antibody (4D1) [H00005058-M02] - Detection limit for recombinant GST tagged PAK1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
4D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PAK1 Antibody (4D1) Summary

Immunogen
PAK1 (NP_002567 191 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
Localization
Cytoplasm. Recruited to focal adhesions upon activation.
Specificity
PAK1 - p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00005058-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAK1 Antibody (4D1)

  • alpha-PAK
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC130000
  • MGC130001
  • p21 protein (Cdc42/Rac)-activated kinase 1
  • p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)
  • p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)
  • p21-activated kinase 1
  • p65-PAK
  • PAK1
  • PAK-1
  • PAKalpha
  • serine/threonine-protein kinase PAK 1
  • STE20 homolog, yeast

Background

PAK proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. These proteins serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 regulates cell motility and morphology. Alternativelt spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37573
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00005058-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for PAK1 Antibody (H00005058-M02)(1)

Reviews for PAK1 Antibody (H00005058-M02) (0)

There are no reviews for PAK1 Antibody (H00005058-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAK1 Antibody (H00005058-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAK1 Products

Bioinformatics Tool for PAK1 Antibody (H00005058-M02)

Discover related pathways, diseases and genes to PAK1 Antibody (H00005058-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK1 Antibody (H00005058-M02)

Discover more about diseases related to PAK1 Antibody (H00005058-M02).
 

Pathways for PAK1 Antibody (H00005058-M02)

View related products by pathway.

PTMs for PAK1 Antibody (H00005058-M02)

Learn more about PTMs related to PAK1 Antibody (H00005058-M02).
 

Research Areas for PAK1 Antibody (H00005058-M02)

Find related products by research area.

Blogs on PAK1.

Myosin is More than Just a Heavy Lifter
Myosin is a well-known, hexameric molecular motor that is a key cytoskeletal component. It consists of a pair of myosin heavy chain subunits (MHC), a pair of essential myosin light chain subunits (MLC), and a pair of regulatory light chain subunits (R...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAK1 Antibody (4D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK1
Entrez
OMIM
Uniprot