PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - HepG2 tissue lysate at a concentration of 0.25ug/ml.

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Human Tonsil Tissue, 4-8ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PA28 Activator gamma Subunit/PSME3. Peptide Sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSME3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24691443).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

• 11S regulator complex gamma subunit
• 11S regulator complex subunit gamma
• Activator of multicatalytic protease subunit 3
• Ki antigen
• Ki
• PA28 Activator gamma Subunit
• PA28g
• PA28gamma
• PA28-gamma
• PA28GKi nuclear autoantigen
• proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
• Proteasome activator 28 subunit gamma
• proteasome activator 28-gamma
• proteasome activator complex subunit 3
• PSME3
• REG gamma
• REG-GAMMA

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)(1)

Publication using NBP1-54587

• Liu YP, Tsai IC, Morleo M et al. Ciliopathy proteins regulate paracrine signaling by modulating proteasomal degradation of mediators. J. Clin. Invest. 2014-04-01 [PMID: 24691443] (WB, Mouse)

Bioinformatics

• Gene Symbol: PSME3
• Entrez:
  • 10197(Human)
• Uniprot:
  • P61289-2(Human)