PA28 Activator gamma Subunit/PSME3 Antibody

Images

 
Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) ...read more
Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - HepG2 tissue lysate at a concentration of 0.25ug/ml.
Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Human Tonsil Tissue, 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PA28 Activator gamma Subunit/PSME3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PSME3(proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)) The peptide sequence was selected from the N terminal of human PSME3. Peptide sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECE
Specificity
This product is specific to Subunit or Isoform: 3.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSME3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PSME3 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
PA28 Activator gamma Subunit/PSME3 Lysate (NBP2-65720)
Publications
Read Publication using
NBP1-54587 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PA28 Activator gamma Subunit/PSME3 Antibody

  • 11S regulator complex gamma subunit
  • 11S regulator complex subunit gamma
  • Activator of multicatalytic protease subunit 3
  • Ki antigen
  • Ki
  • PA28 Activator gamma Subunit
  • PA28g
  • PA28gamma
  • PA28-gamma
  • PA28GKi nuclear autoantigen
  • proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
  • Proteasome activator 28 subunit gamma
  • proteasome activator 28-gamma
  • proteasome activator complex subunit 3
  • PSME3
  • REG gamma
  • REG-GAMMA

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
AF4937
Species: Hu
Applications: WB, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-314
Species: Hu
Applications: WB, IP
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1626
Species: Hu
Applications: WB, ICC
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-66154
Species: Hu
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587) (0)

There are no reviews for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)

Discover related pathways, diseases and genes to PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)

Discover more about diseases related to PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587).
 

Pathways for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)

View related products by pathway.

PTMs for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)

Learn more about PTMs related to PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587).
 

Research Areas for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54587)

Find related products by research area.

Blogs on PA28 Activator gamma Subunit/PSME3

There are no specific blogs for PA28 Activator gamma Subunit/PSME3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA28 Activator gamma Subunit/PSME3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME3
Entrez
Uniprot