p97/VCP Antibody (2H5)

Images

 
Immunocytochemistry/ Immunofluorescence: p97/VCP Antibody (2H5) [H00007415-M15] - Analysis of monoclonal antibody to VCP on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p97/VCP Antibody (2H5) Summary

Immunogen
VCP (AAH07562.2, 221 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
Specificity
Reacts with valosin-containing protein.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VCP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p97/VCP Antibody (2H5)

  • 15S Mg(2+)-ATPase p97 subunit
  • IBMPFD
  • IBMPFDMGC8560
  • MGC131997
  • p97
  • TER ATPase
  • TERA
  • transitional endoplasmic reticulum ATPase
  • valosin containing protein
  • Valosin-containing proteinMGC148092
  • VCP
  • yeast Cdc48p homolog

Background

The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46289
Species: Hu
Applications: WB, IHC
AF2420
Species: Hu
Applications: WB, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00007415-M15
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for p97/VCP Antibody (H00007415-M15) (0)

There are no publications for p97/VCP Antibody (H00007415-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p97/VCP Antibody (H00007415-M15) (0)

There are no reviews for p97/VCP Antibody (H00007415-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p97/VCP Antibody (H00007415-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p97/VCP Products

Bioinformatics Tool for p97/VCP Antibody (H00007415-M15)

Discover related pathways, diseases and genes to p97/VCP Antibody (H00007415-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p97/VCP Antibody (H00007415-M15)

Discover more about diseases related to p97/VCP Antibody (H00007415-M15).
 

Pathways for p97/VCP Antibody (H00007415-M15)

View related products by pathway.

PTMs for p97/VCP Antibody (H00007415-M15)

Learn more about PTMs related to p97/VCP Antibody (H00007415-M15).
 

Research Areas for p97/VCP Antibody (H00007415-M15)

Find related products by research area.

Blogs on p97/VCP

There are no specific blogs for p97/VCP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p97/VCP Antibody (2H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol VCP
Entrez
Uniprot