p53R2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: p53R2 Antibody [NBP1-87368] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: p53R2 Antibody [NBP1-87368] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p53R2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRM2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p53R2 Protein (NBP1-87368PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p53R2 Antibody

  • EC 1.17.4.1
  • MGC102856
  • MGC42116
  • MTDPS8A
  • MTDPS8B
  • p53-inducible ribonucleotide reductase small subunit 2 homolog
  • p53-inducible ribonucleotide reductase small subunit 2-like protein
  • p53R2
  • P53R2DKFZp686M05248
  • PEOA5
  • ribonucleoside-diphosphate reductase subunit M2 B
  • ribonucleotide reductase M2 B (TP53 inducible)
  • RRM2B
  • TP53-inducible ribonucleotide reductase M2 B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52097
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-87368
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for p53R2 Antibody (NBP1-87368) (0)

There are no publications for p53R2 Antibody (NBP1-87368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p53R2 Antibody (NBP1-87368) (0)

There are no reviews for p53R2 Antibody (NBP1-87368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for p53R2 Antibody (NBP1-87368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p53R2 Products

Bioinformatics Tool for p53R2 Antibody (NBP1-87368)

Discover related pathways, diseases and genes to p53R2 Antibody (NBP1-87368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p53R2 Antibody (NBP1-87368)

Discover more about diseases related to p53R2 Antibody (NBP1-87368).
 

Pathways for p53R2 Antibody (NBP1-87368)

View related products by pathway.

PTMs for p53R2 Antibody (NBP1-87368)

Learn more about PTMs related to p53R2 Antibody (NBP1-87368).
 

Research Areas for p53R2 Antibody (NBP1-87368)

Find related products by research area.

Blogs on p53R2

There are no specific blogs for p53R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p53R2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRM2B
Entrez
Uniprot