P311 Antibody - BSA Free

Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells, axons and dendrites.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Staining of human cerebellum shows strong cytoplasmic positivity in dendrites.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P311 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NREP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Please note that ICC/IF was reported in PMID 9270129, which used an older lot that is no longer available. Current lot is not validated for use in ICC/IF.
• Control Peptide:

  P311 Protein (NBP1-84315PEP)

Reactivity Notes

Please note that mouse reactivity was reported in PMID 9270129, which used an older lot that is no longer available. Immunogen has 78% sequence identity with mouse but has not been tested in house.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for P311 Antibody - BSA Free

• chromosome 5 open reading frame 13
• neuronal protein 3.1
• P311PTZ17D4S114
• PRO1873
• Protein p311

Background

C5orf13 may have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration . May also have functions in cellular differentiation . Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for P311 Antibody (NBP1-84315)(3)

Publications using NBP1-84315

• Zhou D, Liu T, Wang S et al. Effects of IL-1? and TNF-? on the Expression of P311 in Vascular Endothelial Cells and Wound Healing in Mice Frontiers in Physiology 2020-11-27 [PMID: 33329015]
• Wang S, Zhang X, Qian W et al. P311 Deficiency Leads to Attenuated Angiogenesis in Cutaneous Wound Healing. Front Physiol 2017-12-06 [PMID: 29270129] (IHC-P, Mouse)
• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

FAQs for P311 Antibody (NBP1-84315). (Showing 1 - 1 of 1 FAQs).

1. I am interested in your P311(c5orf13) antibody [cat#NBP1-84315]. Can you let me know of any references for this product?
   • Unfortunately this antibody has not yet been referenced in any published papers, however I can assure you that all our products are quality control tested and we fully guarantee them if they do not function correctly.

Bioinformatics

• Gene Symbol: NREP