P311 Antibody


Immunohistochemistry-Paraffin: P311 Antibody [NBP1-84315] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

P311 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
Specificity of human, mouse P311 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
P311 Protein (NBP1-84315PEP)
Read Publications using
NBP1-84315 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29270129).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for P311 Antibody

  • chromosome 5 open reading frame 13
  • neuronal protein 3.1
  • P311PTZ17D4S114
  • PRO1873
  • Protein p311


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for P311 Antibody (NBP1-84315)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for P311 Antibody (NBP1-84315) (0)

There are no reviews for P311 Antibody (NBP1-84315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for P311 Antibody (NBP1-84315). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in your P311(c5orf13) antibody [cat#NBP1-84315]. Can you let me know of any references for this product?
    • Unfortunately this antibody has not yet been referenced in any published papers, however I can assure you that all our products are quality control tested and we fully guarantee them if they do not function correctly.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-84315

Bioinformatics Tool for P311 Antibody (NBP1-84315)

Discover related pathways, diseases and genes to P311 Antibody (NBP1-84315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P311 Antibody (NBP1-84315)

Discover more about diseases related to P311 Antibody (NBP1-84315).

Pathways for P311 Antibody (NBP1-84315)

View related products by pathway.

PTMs for P311 Antibody (NBP1-84315)

Learn more about PTMs related to P311 Antibody (NBP1-84315).

Blogs on P311

There are no specific blogs for P311, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our P311 Antibody and receive a gift card or discount.


Gene Symbol NREP