P311 Antibody

Images

 
Immunohistochemistry-Paraffin: P311 Antibody [NBP1-84315] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P311 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
Specificity
Specificity of human P311 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NREP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publications using
NBP1-84315 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29270129).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P311 Antibody

  • chromosome 5 open reading frame 13
  • neuronal protein 3.1
  • P311PTZ17D4S114
  • PRO1873
  • Protein p311

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP2-67635
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB38352
Species: Hu, Mu
Applications: WB, ICC
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
NBP2-76836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-92685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC

Publications for P311 Antibody (NBP1-84315)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for P311 Antibody (NBP1-84315) (0)

There are no reviews for P311 Antibody (NBP1-84315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for P311 Antibody (NBP1-84315). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in your P311(c5orf13) antibody [cat#NBP1-84315]. Can you let me know of any references for this product?
    • Unfortunately this antibody has not yet been referenced in any published papers, however I can assure you that all our products are quality control tested and we fully guarantee them if they do not function correctly.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional P311 Products

Array NBP1-84315

Bioinformatics Tool for P311 Antibody (NBP1-84315)

Discover related pathways, diseases and genes to P311 Antibody (NBP1-84315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P311 Antibody (NBP1-84315)

Discover more about diseases related to P311 Antibody (NBP1-84315).
 

Pathways for P311 Antibody (NBP1-84315)

View related products by pathway.

PTMs for P311 Antibody (NBP1-84315)

Learn more about PTMs related to P311 Antibody (NBP1-84315).

Blogs on P311

There are no specific blogs for P311, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P311 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NREP
COVID-19 update