Novus Biologicals Rabbit P311 Antibody - BSA Free (NBP1-84315) is a polyclonal antibody validated for use in IHC. Anti-P311 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NREP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Please note that ICC/IF was reported in PMID 9270129, which used an older lot that is no longer available. Current lot is not validated for use in ICC/IF.
Please note that mouse reactivity was reported in PMID 9270129, which used an older lot that is no longer available. Immunogen has 78% sequence identity with mouse but has not been tested in house.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for P311 Antibody - BSA Free
chromosome 5 open reading frame 13
neuronal protein 3.1
P311PTZ17D4S114
PRO1873
Protein p311
Background
C5orf13 may have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration . May also have functions in cellular differentiation . Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboi
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for P311 Antibody (NBP1-84315). (Showing 1 - 1 of 1 FAQs).
I am interested in your P311(c5orf13) antibody [cat#NBP1-84315]. Can you let me know of any references for this product?
Unfortunately this antibody has not yet been referenced in any published papers, however I can assure you that all our products are quality control tested and we fully guarantee them if they do not function correctly.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our P311 Antibody - BSA Free and receive a gift card or discount.