P2Y12/P2RY12 Antibody [Biotin]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Biotin

P2Y12/P2RY12 Antibody [Biotin] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2Y12/P2RY12 (NP_795345.1).
  
  Sequence:
  INFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for P2Y12/P2RY12 Antibody [Biotin]

• ADPG-R
• Gi-coupled ADP receptor HORK3
• HORK3
• HORK3P2Y12 platelet ADP receptor
• P2RY12
• P2T(AC)
• P2Y purinoceptor 12
• P2Y(AC)
• P2Y(ADP)
• P2Y(cyc)
• P2Y12
• P2Y12ADP-glucose receptor
• purinergic receptor P2RY12
• purinergic receptor P2Y, G-protein coupled, 12
• putative G-protein coupled receptor
• SP1999
• SP1999G-protein coupled receptor SP1999

Background

P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P2RY12