P-Selectin/CD62P Recombinant Protein Antigen

Images

 
There are currently no images for P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

P-Selectin/CD62P Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SELP.

Source: E. coli

Amino Acid Sequence: GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SELP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85744. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for P-Selectin/CD62P Recombinant Protein Antigen

  • CD62P antigen
  • CD62P
  • FLJ45155
  • GMP140
  • GRMP
  • PADGEM
  • PADGEMantigen CD62)
  • PSEL
  • P-Selectin
  • selectin P (granule membrane protein 140kDa, antigen CD62)
  • SELP

Background

CD62P is a member of the small selectin family of cellular adhesion molecules, which also includes CD62E and CD62L. Its structure, similar to the other members of the selectin family, consists of an N terminal lectin like domain of C type, followed by an epidermal growth factor like motif, a series of short consensus repeats, a transmembrane domain, and a cytoplasmic tail. The CD62P antigen is a 140 kDa glycoprotein, located in the alpha granules and the dense granules of platelets and endothelial cells. Activation of these cells results in rapid mobilization of CD62P from the storage granules to the cell surface. Activated platelets have a stable CD62P expression, while the endothelial cells lose CD62P expression within 1 h of activation, because of endocytosis of the molecule. CD62P is also expressed on megakaryocytes, but resting platelets and endothelial cells show no surface staining of CD62P.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
7268-CT
Species: Hu
Applications: BA
DCDL40
Species: Hu
Applications: ELISA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
M6000B
Species: Mu
Applications: ELISA
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB100-78039
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP2-57949
Species: Hu
Applications: ICC/IF
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-85744PEP
Species: Hu
Applications: AC

Publications for P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP) (0)

There are no publications for P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP) (0)

There are no reviews for P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P-Selectin/CD62P Products

Blogs on P-Selectin/CD62P

There are no specific blogs for P-Selectin/CD62P, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our P-Selectin/CD62P Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SELP