OVCA1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: OVCA1 Antibody [NBP2-57765] - Staining of human cell line A549 shows localization to nucleoplasm & cell junctions.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OVCA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OVCA1 Antibody - BSA Free (NBP2-57765) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OVCA1 Recombinant Protein Antigen (NBP2-57765PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OVCA1 Antibody - BSA Free

• Diphthamide biosynthesis protein 2 homolog-like 1
• Diphthamide biosynthesis protein 2-like
• diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1
• diptheria toxin resistance protein required for diphthamide biosynthesis-like 1
• diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae)
• DPH1 homolog (S. cerevisiae)
• DPH1 homolog
• DPH2L
• DPH2L1diphthamide biosynthesis protein 1
• DPH2-like 1
• DPH-like 1 (S. cerevisiae)
• DPH-like 1
• FLJ33211
• hsDph1
• Ovarian cancer-associated gene 1 protein
• ovarian tumor suppressor candidate 1
• OVCA1candidate tumor suppressor in ovarian cancer 1

Background

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPH1