DPH3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DPH3 Antibody [NBP1-84276] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DPH3 Antibody [NBP1-84276] - Staining of human spleen shows distinct cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPH3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPH3 Protein (NBP1-84276PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPH3 Antibody

  • DelGEF-interacting protein 1
  • DELGIP
  • DelGIP1
  • DELGIP1deafness locus putative guanine nucleotide exchange factor interacting protein1
  • DESR1CSL-type zinc finger-containing protein 2
  • DPH3 homolog (KTI11, S. cerevisiae)
  • DPH3 homolog
  • DPH3, KTI11 homolog (S. cerevisiae)
  • DPH3A
  • DPH3A, KTI11 homolog A
  • KTI11Del-GEF interacting protein
  • MGC20197
  • ZCSL2diphtheria toxin and Pseudomonas exotoxin A sensitivity required gene 1
  • zinc finger, CSL domain containing 2
  • zinc finger, CSL-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-59312
Species: Hu
Applications: WB
NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC
AF4079
Species: Hu
Applications: WB, ICC
NBP2-03732
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, IHC, IHC-P
NBP2-13934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88025
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81176
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87969
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-84625
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DPH3 Antibody (NBP1-84276) (0)

There are no publications for DPH3 Antibody (NBP1-84276).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPH3 Antibody (NBP1-84276) (0)

There are no reviews for DPH3 Antibody (NBP1-84276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DPH3 Antibody (NBP1-84276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPH3 Products

Bioinformatics Tool for DPH3 Antibody (NBP1-84276)

Discover related pathways, diseases and genes to DPH3 Antibody (NBP1-84276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPH3 Antibody (NBP1-84276)

Discover more about diseases related to DPH3 Antibody (NBP1-84276).
 

Pathways for DPH3 Antibody (NBP1-84276)

View related products by pathway.

PTMs for DPH3 Antibody (NBP1-84276)

Learn more about PTMs related to DPH3 Antibody (NBP1-84276).

Blogs on DPH3

There are no specific blogs for DPH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPH3