OTUD7B/Cezanne/ZA20D1 Antibody

Images

 
Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP2-87998] - WB Suggested Anti-OTUD7B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 293T cell lysate
Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP2-87998] - Rabbit Anti-OTUD7B Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTUD7B/Cezanne/ZA20D1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OTUD7B/Cezanne/ZA20D1. Peptide sequence: VGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
OTUD7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OTUD7B/Cezanne/ZA20D1 Antibody

  • cellular zinc finger NF-kappaB Cezanne
  • Cellular zinc finger NF-kappa-B protein
  • Cezanne
  • CEZANNEA20 domain containing 1
  • EC 3.4.19.12
  • OTU domain containing 7B
  • OTU domain-containing protein 7B
  • OTUD7B
  • ZA20D1
  • Zinc finger A20 domain-containing protein 1
  • Zinc finger protein Cezanne

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87826
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-02293
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
H00000582-P01
Species: Hu
Applications: ELISA, Func, AP, PA, WB
NBP1-89926
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
796-IC
Species: Mu
Applications: BA
NLS272
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP1-01469
Species: Hu
Applications: PEP-ELISA, WB
201-LB/CF
Species: Hu
Applications: BA
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87998
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998) (0)

There are no publications for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998) (0)

There are no reviews for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTUD7B/Cezanne/ZA20D1 Products

Bioinformatics Tool for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998)

Discover related pathways, diseases and genes to OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998)

Discover more about diseases related to OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998).
 

Pathways for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998)

View related products by pathway.

PTMs for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998)

Learn more about PTMs related to OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998).
 

Research Areas for OTUD7B/Cezanne/ZA20D1 Antibody (NBP2-87998)

Find related products by research area.

Blogs on OTUD7B/Cezanne/ZA20D1

There are no specific blogs for OTUD7B/Cezanne/ZA20D1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTUD7B/Cezanne/ZA20D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUD7B