Osterix/Sp7 Antibody - BSA Free

Immunohistochemistry-Paraffin: Osterix/Sp7 Antibody [NBP2-38019] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: Osterix/Sp7 Antibody [NBP2-38019] - Staining of human testis shows distinct nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Osterix/Sp7 Antibody [NBP2-38019] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Osterix/Sp7 Antibody [NBP2-38019] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Osterix/Sp7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Osterix/Sp7 Antibody - BSA Free (NBP2-38019) is a polyclonal antibody validated for use in IHC. Anti-Osterix/Sp7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSG
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Osterix/Sp7 Protein (NBP2-38019PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Osterix/Sp7 Antibody - BSA Free

• MGC126598
• Osterix
• OSX
• OSXosterix
• Sp7 transcription factor
• Sp7
• transcription factor Sp7
• Zinc finger protein osterix

Background

SP7 is a C2H2-type zinc finger transcription factor of the SP gene family and a putative master regulator of bone cell differentiation (Gao et al., 2004 [PubMed 15474293]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osterix/Sp7 Antibody (NBP2-38019)(1)

Publication using NBP2-38019

• Malwine J. Barz, Lena Behrmann, Danaëlle Capron, Gabriele Zuchtriegel, Fabio D. Steffen, Leo Kunz, Yang Zhang, Iria Jimenez Vermeerbergen, Blerim Marovca, Moritz Kirschmann, Antonia Zech, César Nombela-Arrieta, Urs Ziegler, Timm Schroeder, Beat Bornhauser, Jean-Pierre Bourquin B- and T-cell acute lymphoblastic leukemias evade chemotherapy at distinct sites in the bone marrow Haematologica 2022-11-03 [PMID: 36325888]

Bioinformatics

• Gene Symbol: SP7
• Uniprot:
  • Q8TDD2(Human)