Osteopontin/OPN Recombinant Protein Antigen

Images

 
There are currently no images for Osteopontin/OPN Protein (NBP1-89952PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Osteopontin/OPN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPP1.

Source: E. coli

Amino Acid Sequence: SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89952.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Osteopontin/OPN Recombinant Protein Antigen

  • BNSP
  • Bone sialoprotein 1
  • Eta-1
  • MGC110940
  • Nephropontin
  • OPN
  • Osteopontin
  • secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1)
  • secreted phosphoprotein-1 (osteopontin, bone sialoprotein)
  • Spp1
  • SPP-1
  • SPP1/CALPHA1 fusion
  • Urinary stone protein
  • uropontin

Background

Osteopontin is the principal phosphorylated glycoprotein of bone and is expressed in a limited number of other tissues including dentine. Osteopontin is produced by osteoblasts under stimulation by calcitriol and binds tightly to hydroxyapatite. It is also involved in the anchoring of osteoclasts to the mineral of bone matrix via the vitronectin receptor, which has specificity for osteopontin. Osteopontin is overexpressed in a variety of cancers, including lung, breast, colorectal, stomach, ovarian, melanoma and mesothelioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
4014-SP
Species: Hu
Applications: BA
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
DCC270
Species: Hu
Applications: ELISA
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-92749
Species: Hu, Mu
Applications: WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DY805
Species: Hu
Applications: ELISA
355-BM
Species: Hu, Mu, Rt
Applications: BA
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-92546
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-89952PEP
Species: Hu
Applications: AC

Publications for Osteopontin/OPN Protein (NBP1-89952PEP) (0)

There are no publications for Osteopontin/OPN Protein (NBP1-89952PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteopontin/OPN Protein (NBP1-89952PEP) (0)

There are no reviews for Osteopontin/OPN Protein (NBP1-89952PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Osteopontin/OPN Protein (NBP1-89952PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Osteopontin/OPN Products

Research Areas for Osteopontin/OPN Protein (NBP1-89952PEP)

Find related products by research area.

Blogs on Osteopontin/OPN.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Osteopontin/OPN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPP1