OSMR beta Antibody - Azide and BSA Free

Western Blot: OSMR Antibody [H00009180-B01P] - Analysis of OSMR expression in transfected 293T cell line by OSMR polyclonal antibody. Lane 1: OSMR transfected lysate(37.62 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OSMR beta Antibody - Azide and BSA Free Summary

• Immunogen: OSMR (AAH10943, 1 a.a. - 342 a.a.) full-length human protein. MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
• Specificity: OSMR - oncostatin M receptor,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: OSMR
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OSMR beta Antibody - Azide and BSA Free

• IL-31 receptor subunit beta
• IL-31R subunit beta
• IL-31RB
• IL-31R-beta
• Interleukin-31 receptor subunit beta
• MGC150627
• MGC75127
• oncostatin M receptor
• oncostatin-M specific receptor beta subunit
• oncostatin-M-specific receptor subunit beta
• OSM R beta
• OSMR beta
• OSMR
• OSMRB
• OSMRBMGC150626
• PLCA1

Background

Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OSMR beta Antibody (H00009180-B01P)(2)

Publications using H00009180-B01P

• A Sharanek, A Burban, M Laaper, E Heckel, JS Joyal, VD Soleimani, A Jahani-Asl OSMR controls glioma stem cell respiration and confers resistance of glioblastoma to ionizing radiation Nat Commun, 2020-08-17;11(1):4116. 2020-08-17 [PMID: 32807793]
• Jahani-Asl A, Yin H, Soleimani VD et al. Control of glioblastoma tumorigenesis by feed-forward cytokine signaling. Nat Neurosci 2016-06-01 [PMID: 27110918]

Bioinformatics

• Gene Symbol: OSMR
• Entrez:
  • 9180(Human)
• Uniprot:
  • AAH10943(Human)