OSGIN1 Antibody - BSA Free

Western Blot: OSGIN1 Antibody [NBP1-59296] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OSGIN1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OSGIN1(oxidative stress induced growth inhibitor 1) The peptide sequence was selected from the N terminal of OSGIN1. Peptide sequence APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSGIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OSGIN1 Antibody - BSA Free

• BDGI
• bone marrow stromal cell-derived growth inhibitor
• EC 1.6.5
• EC 2.4.2.7
• EC 2.7.1.130
• huOKL38
• OKL38oxidative stress-induced growth inhibitor 1
• Ovary, kidney and liver protein 38
• oxidative stress induced growth inhibitor 1
• pregnancy induced growth inhibitor
• Pregnancy-induced growth inhibitor OKL38

Background

OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSGIN1
• Uniprot:
  • Q9UJX0(Human)