OSBPL5 Antibody - BSA Free

Western Blot: OSBPL5 Antibody [NBP1-81403] - Analysis in control (vector only transfected HEK293T lysate) and OSBPL5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: OSBPL5 Antibody [NBP1-81403] - Staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: OSBPL5 Antibody [NBP1-81403] - Staining of human liver shows low positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: OSBPL5 Antibody [NBP1-81403] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: OSBPL5 Antibody [NBP1-81403] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: OSBPL5 Antibody [NBP1-81403] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Western Blot: OSBPL5 Antibody [NBP1-81403] - Western Blot of the lysate of PC-3 cells - control and ORP5 knockdown. Image from verified customer review.

Immunohistochemistry-Paraffin: Rabbit Polyclonal OSBPL5 Antibody [NBP1-81403] - OSBPL5 IHC (brown) in the prostate tumor tissues from prostate cancer patients, bars, 200 μm. Image from a verified customer review.

Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal OSBPL5 Antibody [NBP1-81403] - Primary mouse hepatocytes stained with OSBPL5 Antibody. Image from a verified customer review.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OSBPL5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OSBPL5 Antibody - BSA Free (NBP1-81403) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSBPL5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OSBPL5 Protein (NBP1-81403PEP)

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OSBPL5 Antibody - BSA Free

• EC 1.2.1
• EC 2.7.7.6
• FLJ42929
• KIAA1534oxysterol-binding protein-related protein 5
• OBPH1
• ORP-5
• ORP5oxysterol-binding protein homologue 1
• OSBP-related protein 5
• oxysterol binding protein-like 5
• oxysterol-binding protein homolog 1
• Oxysterol-binding protein homolog 1;

Background

OSBPL5 encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for OSBPL5 Antibody (NBP1-81403) (3)

Average Rating: 5

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Mouse.

reviewed by: Armen Petrosyan IF Mouse 11/19/2024

Summary

• Application: Immunofluorescence
• Sample Tested: Primary mouse hepatocytes
• Species: Mouse
• Lot: 000000580

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

reviewed by: Armen Petrosyan IHC-P Human 11/07/2024

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Prostate tissue
• Species: Human
• Lot: 000000580

reviewed by: Armen Petrosyan WB Human 06/27/2023

Summary

• Application: Western Blot
• Sample Tested: PC-3 human prostate cancer cell line
• Species: Human
• Lot: 000000580

Comments

• Comments: W-B of the lysate of PC-3 cells - control and ORP5 knockdown

Bioinformatics

• Gene Symbol: OSBPL5