TSSC4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TSSC4 Antibody [NBP1-85838] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: TSSC4 Antibody [NBP1-85838] - Staining of human kidney shows strong cytoplasmic and moderate nuclear positivity in subsets of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSSC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSSC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSSC4 Protein (NBP1-85838PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSSC4 Antibody

  • protein TSSC4
  • tumor suppressing subtransferable candidate 4
  • Tumor-suppressing STF cDNA 4 protein
  • Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-98867
Species: Rt
Applications: WB, IHC
NBP1-87282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-83046
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-81403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2131
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB110-74925
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-86710
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TSSC4 Antibody (NBP1-85838) (0)

There are no publications for TSSC4 Antibody (NBP1-85838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSSC4 Antibody (NBP1-85838) (0)

There are no reviews for TSSC4 Antibody (NBP1-85838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TSSC4 Antibody (NBP1-85838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSSC4 Products

Bioinformatics Tool for TSSC4 Antibody (NBP1-85838)

Discover related pathways, diseases and genes to TSSC4 Antibody (NBP1-85838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSC4 Antibody (NBP1-85838)

Discover more about diseases related to TSSC4 Antibody (NBP1-85838).

PTMs for TSSC4 Antibody (NBP1-85838)

Learn more about PTMs related to TSSC4 Antibody (NBP1-85838).

Blogs on TSSC4

There are no specific blogs for TSSC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSSC4