TSSC4 Antibody

Immunohistochemistry-Paraffin: TSSC4 Antibody [NBP1-85838] - Staining of human kidney shows strong cytoplasmic and moderate nuclear positivity in subsets of tubules.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TSSC4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSSC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSSC4 Protein (NBP1-85838PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSSC4 Antibody

• protein TSSC4
• tumor suppressing subtransferable candidate 4
• Tumor-suppressing STF cDNA 4 protein
• Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein

Background

The TSSC4 gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSSC4