OS9 Antibody

Images

 
Immunohistochemistry-Paraffin: OS9 Antibody [NBP1-84803] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OS9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OS9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OS9 Protein (NBP1-84803PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OS9 Antibody

  • Amplified in osteosarcoma 9
  • endoplasmic reticulum lectin 2
  • ERLEC2
  • erlectin 2
  • OS-9
  • osteosarcoma amplified 9, endoplasmic reticulum associated protein
  • osteosarcoma amplified 9, endoplasmic reticulum lectin
  • protein OS-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86802
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1543
Species: Hu
Applications: WB, IHC
H00054431-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NB100-485
Species: Hu
Applications: WB, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB7824
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-59068
Species: Hu
Applications: WB
NBP1-84803
Species: Hu
Applications: IHC, IHC-P

Publications for OS9 Antibody (NBP1-84803) (0)

There are no publications for OS9 Antibody (NBP1-84803).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OS9 Antibody (NBP1-84803) (0)

There are no reviews for OS9 Antibody (NBP1-84803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OS9 Antibody (NBP1-84803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OS9 Products

Bioinformatics Tool for OS9 Antibody (NBP1-84803)

Discover related pathways, diseases and genes to OS9 Antibody (NBP1-84803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OS9 Antibody (NBP1-84803)

Discover more about diseases related to OS9 Antibody (NBP1-84803).
 

Pathways for OS9 Antibody (NBP1-84803)

View related products by pathway.

PTMs for OS9 Antibody (NBP1-84803)

Learn more about PTMs related to OS9 Antibody (NBP1-84803).
 

Research Areas for OS9 Antibody (NBP1-84803)

Find related products by research area.

Blogs on OS9.

OS9: Taking proteins to the ER finish line
The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OS9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OS9