ORP8 Antibody - BSA Free

Western Blot: ORP8 Antibody [NBP1-59815] - HT1080, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.

Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ORP8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the middle region of OSBPL8. Peptide sequence YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSBPL8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 97 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ORP8 Antibody - BSA Free

• MGC126578
• MGC133203
• MST120
• MSTP120
• ORP-8
• ORP8KIAA1451
• OSBP10DKFZp686A11164
• OSBP-related protein 8
• oxysterol binding protein-like 8
• oxysterol-binding protein-related protein 8

Background

OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSBPL8
• Uniprot:
  • Q68D75(Human)