Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | OSBPL3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-82968 | Applications | Species |
---|---|---|
Zhang M, Meng L, Zhang Z et al. The relationships of OSBPL3 expression with KI-67 expression and KRAS mutations in CRC: implications for diagnosis and prognosis BMC medical genomics 2022-12-14 [PMID: 36517805] (IHC, Human) | IHC | Human |
Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965] | ||
Zhang M, Meng L, Zhang Z et al. The respective relations of expression of OSBPL3 with Ki-67 expression and KRAS mutation in CRC for diagnosis and prognosis Research Square 2022-03-28 (IF/IHC) | IF/IHC |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Nora Mellouk |
IF | Human | 11/01/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for OSBPL3 Antibody (NBP1-82968)Discover more about diseases related to OSBPL3 Antibody (NBP1-82968).
| Pathways for OSBPL3 Antibody (NBP1-82968)View related products by pathway.
|
PTMs for OSBPL3 Antibody (NBP1-82968)Learn more about PTMs related to OSBPL3 Antibody (NBP1-82968).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | OSBPL3 |