OSBPL3 Antibody

Images

 
Orthogonal Strategies: Western Blot: OSBPL3 Antibody [NBP1-82968] - Analysis in human cell lines A-431 and MCF-7 using Anti-OSBPL3 antibody. Corresponding OSBPL3 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: OSBPL3 Antibody [NBP1-82968] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining in human urinary bladder and pancreas tissues using anti-OSBPL3 antibody. Corresponding OSBPL3 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human urinary bladder shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

OSBPL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE
Specificity
Specificity of human OSBPL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSBPL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82968 in the following applications:

Publications
Read Publication using NBP1-82968.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OSBPL3 Antibody

  • DKFZp667P1518
  • KIAA0704ORP3ORP-3OSBP3
  • MGC21526
  • OSBP-related protein 3
  • oxysterol binding protein-like 3
  • oxysterol-binding protein 3
  • oxysterol-binding protein-related protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-P01
Species: Hu
MAB9120
Species: Hu
Applications: ICC
AF7629
Species: Hu
Applications: WB, IHC, ICC
NBP1-31456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81054
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-04611
Species: Hu
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OSBPL3 Antibody (NBP1-82968)(1)

Review for OSBPL3 Antibody (NBP1-82968) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-82968:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence OSBPL3 NBP1-82968
Enlarge
reviewed by:
Anonymous
IF Human 11/01/2017
View

Summary

ApplicationImmunofluorescence
Sample Tested hela cell
SpeciesHuman
LotA96037

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OSBPL3 Antibody (NBP1-82968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OSBPL3 Products

Bioinformatics Tool for OSBPL3 Antibody (NBP1-82968)

Discover related pathways, diseases and genes to OSBPL3 Antibody (NBP1-82968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBPL3 Antibody (NBP1-82968)

Discover more about diseases related to OSBPL3 Antibody (NBP1-82968).
 

Pathways for OSBPL3 Antibody (NBP1-82968)

View related products by pathway.

PTMs for OSBPL3 Antibody (NBP1-82968)

Learn more about PTMs related to OSBPL3 Antibody (NBP1-82968).

Blogs on OSBPL3

There are no specific blogs for OSBPL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
11/01/2017
Application: IF
Species: Human

Bioinformatics

Gene Symbol OSBPL3
COVID-19 update