OSBPL2 Antibody

Images

 
Western Blot: OSBPL2 Antibody [NBP1-92236] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: OSBPL2 Antibody [NBP1-92236] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OSBPL2 Antibody [NBP1-92236] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OSBPL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRT
Specificity
Specificity of human OSBPL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSBPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP1-92236 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OSBPL2 Antibody

  • KIAA0772FLJ20223
  • ORP-2MGC4307
  • ORP2MGC8342
  • OSBP-related protein 2
  • oxysterol binding protein-like 2
  • oxysterol-binding protein-like 2
  • oxysterol-binding protein-related protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-46175
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-06099
Species: Hu
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2448
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBL1-11664
Species: Hu
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OSBPL2 Antibody (NBP1-92236) (0)

There are no publications for OSBPL2 Antibody (NBP1-92236).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for OSBPL2 Antibody (NBP1-92236) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-92236:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot OSBPL2 NBP1-92236
Enlarge
reviewed by:
Anonymous
WB Human 04/15/2019
View

Summary

ApplicationWestern Blot
Sample Tested Hela whole cell lysate
SpeciesHuman
LotR37358

Comments

CommentsPrimary antibody used at 1:1000 overnight at 4°C.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OSBPL2 Antibody (NBP1-92236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OSBPL2 Products

Bioinformatics Tool for OSBPL2 Antibody (NBP1-92236)

Discover related pathways, diseases and genes to OSBPL2 Antibody (NBP1-92236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBPL2 Antibody (NBP1-92236)

Discover more about diseases related to OSBPL2 Antibody (NBP1-92236).
 

Pathways for OSBPL2 Antibody (NBP1-92236)

View related products by pathway.

Research Areas for OSBPL2 Antibody (NBP1-92236)

Find related products by research area.

Blogs on OSBPL2

There are no specific blogs for OSBPL2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
04/15/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol OSBPL2
COVID-19 update