OSBP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OSBP2 Antibody [NBP1-81388] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OSBP2 Antibody [NBP1-81388] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OSBP2 Antibody [NBP1-81388] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: OSBP2 Antibody [NBP1-81388] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: OSBP2 Antibody [NBP1-81388] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OSBP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITV
Specificity
Specificity of human OSBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OSBP2 Antibody

  • ORP4ORP-4KIAA1664Oxysterol-binding protein-related protein 4
  • OSBPL1
  • OSBPL4
  • OSBP-related protein 4
  • oxysterol binding protein 2
  • oxysterol binding protein-like 1
  • oxysterol binding protein-related protein 4
  • oxysterol-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92236
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85872
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00089845-P01
Species: Hu
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81054
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59815
Species: Hu
Applications: WB
NB100-2448
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-03327
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for OSBP2 Antibody (NBP1-81388) (0)

There are no publications for OSBP2 Antibody (NBP1-81388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBP2 Antibody (NBP1-81388) (0)

There are no reviews for OSBP2 Antibody (NBP1-81388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OSBP2 Antibody (NBP1-81388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OSBP2 Products

Bioinformatics Tool for OSBP2 Antibody (NBP1-81388)

Discover related pathways, diseases and genes to OSBP2 Antibody (NBP1-81388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBP2 Antibody (NBP1-81388)

Discover more about diseases related to OSBP2 Antibody (NBP1-81388).
 

Pathways for OSBP2 Antibody (NBP1-81388)

View related products by pathway.

Research Areas for OSBP2 Antibody (NBP1-81388)

Find related products by research area.

Blogs on OSBP2

There are no specific blogs for OSBP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSBP2
COVID-19 update