ORC5L Recombinant Protein Antigen

Images

 
There are currently no images for ORC5L Protein (NBP1-82476PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ORC5L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ORC5.

Source: E.coli

Amino Acid Sequence: GEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ORC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82476.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ORC5L Recombinant Protein Antigen

  • ORC5Lorigin recognition complex, subunit 5-like (yeast)
  • ORC5P
  • ORC5T
  • origin recognition complex subunit 5
  • origin recognition complex, subunit 5 (yeast homolog)-like
  • origin recognition complex, subunit 5 homolog (yeast)
  • origin recognition complex, subunit 5
  • origin recognition complex, subunit 5-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06099
Species: Hu
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-253
Species: Hu
Applications: WB, IP
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for ORC5L Protein (NBP1-82476PEP) (0)

There are no publications for ORC5L Protein (NBP1-82476PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC5L Protein (NBP1-82476PEP) (0)

There are no reviews for ORC5L Protein (NBP1-82476PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ORC5L Protein (NBP1-82476PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORC5L Products

Bioinformatics Tool for ORC5L Protein (NBP1-82476PEP)

Discover related pathways, diseases and genes to ORC5L Protein (NBP1-82476PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC5L Protein (NBP1-82476PEP)

Discover more about diseases related to ORC5L Protein (NBP1-82476PEP).
 

Pathways for ORC5L Protein (NBP1-82476PEP)

View related products by pathway.

PTMs for ORC5L Protein (NBP1-82476PEP)

Learn more about PTMs related to ORC5L Protein (NBP1-82476PEP).

Blogs on ORC5L

There are no specific blogs for ORC5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ORC5L Antibody
NBP1-82476

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ORC5L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC5