ORAI3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ORAI3 Antibody [NBP1-93523] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ORAI3 Antibody [NBP1-93523] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORAI3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA
Specificity
Specificity of human ORAI3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORAI3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Western Blot reactivity reported in (PMID: 25126575).
Control Peptide
Publications
Read Publications using
NBP1-93523 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24603752)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ORAI3 Antibody

  • ORAI calcium release-activated calcium modulator 3
  • TMEM142C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ISH, PLA, IF
H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-19630
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76790
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu, Mu, Rt, Bv, Gt, GP
Applications: WB, IHC, IHC-P
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NBP1-20989
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00003783-D01P
Species: Hu
Applications: WB
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF640
Species: Mu
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-77262
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for ORAI3 Antibody (NBP1-93523)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ORAI3 Antibody (NBP1-93523) (0)

There are no reviews for ORAI3 Antibody (NBP1-93523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ORAI3 Antibody (NBP1-93523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ORAI3 Products

Bioinformatics Tool for ORAI3 Antibody (NBP1-93523)

Discover related pathways, diseases and genes to ORAI3 Antibody (NBP1-93523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORAI3 Antibody (NBP1-93523)

Discover more about diseases related to ORAI3 Antibody (NBP1-93523).
 

Pathways for ORAI3 Antibody (NBP1-93523)

View related products by pathway.

PTMs for ORAI3 Antibody (NBP1-93523)

Learn more about PTMs related to ORAI3 Antibody (NBP1-93523).

Blogs on ORAI3

There are no specific blogs for ORAI3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORAI3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORAI3