Orai2 Recombinant Protein Antigen

Images

 
There are currently no images for Orai2 Recombinant Protein Antigen (NBP2-55443PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Orai2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Orai2.

Source: E. coli

Amino Acid Sequence: MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ORAI2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55443.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Orai2 Recombinant Protein Antigen

  • C7orf19
  • CAP-binding protein complex interacting protein 2
  • CAP-binding protein complex-interacting protein 2
  • CBCIP2
  • CBCIP2C7orf19FLJ12474
  • chromosome 7 open reading frame 19
  • FLJ14733
  • H_NH0514P08.8
  • MEM142B
  • ORAI calcium release-activated calcium modulator 2
  • Orai2
  • PP1729
  • protein orai-2
  • putative protein ORAI2-2
  • TMEM142B
  • Transmembrane protein 142BFLJ44818

Background

STIM-Orai channels have recently been identified as the underlying molecular mechanism of store-operated calcium entry(SOCE). SOCE allows rapid Ca2+ efflux from the endoplasmic reticulum (ER), following the emptying of intracellularCa2+ stores. STIM (sensors stromal interaction molecule) proteins, STIM1 and STIM2, serve as ER Ca2+ sensors. Theycontain N'-terminal Ca2+-sensing EF-hand domains and are localized to the tubular ER. Following Ca2+ store depletion,STIMs rapidly cluster and relocalize to the plasma membrane-adjacent ER regions, where they oligomerize and form'puncta'. Orai proteins, Orai1, Orai2 and Orai3, are STIM binding partners that form the pore of the channel. Oraiproteins are uniformly distributed in the plasma membrane and exist as dimers in the resting state. STIM activationinduces tetramerization of Orai proteins and subsequent STIM-Orai colocalization, which forms the activestore-operated calcium channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-75522
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, PLA, WB
H00006786-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-93523
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35783
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-45656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-33694
Species: Hu
Applications: IHC,  IHC-P
NBP1-20989
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-21886
Species: Hu, Mu, Rt
Applications: WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA

Publications for Orai2 Recombinant Protein Antigen (NBP2-55443PEP) (0)

There are no publications for Orai2 Recombinant Protein Antigen (NBP2-55443PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Orai2 Recombinant Protein Antigen (NBP2-55443PEP) (0)

There are no reviews for Orai2 Recombinant Protein Antigen (NBP2-55443PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Orai2 Recombinant Protein Antigen (NBP2-55443PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Orai2 Products

Research Areas for Orai2 Recombinant Protein Antigen (NBP2-55443PEP)

Find related products by research area.

Blogs on Orai2

There are no specific blogs for Orai2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Orai2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ORAI2