Oncostatin M/OSM Antibody (8O8K9) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Oncostatin M/OSM (P13725). MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
OSM |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
- Immunohistochemistry
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Oncostatin M/OSM Antibody (8O8K9)
Background
Oncostatin M is a 252 amino acid protein that is 28 kDa, acts as growth regulator inhibiting the proliferation of a number of tumor cell lines and stimulating the proliferation of AIDS-KS cells; regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells; uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST), and is involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. This protein is being studied for its involvement in several diseases and disorders including arterial occlusive disease, peripheral arterial occlusive disease, leukemia, kaposi's sarcoma, abdominal aortic aneurysm, status epilepticus, primary cutaneous amyloidosis, aortic aneurysm, bullous pemphigoid, neonatal jaundice, cutaneous malignant melanoma, plasmacytoma, systemic mastocytosis, mastocytosis, cervical squamous cell carcinoma, systemic lupus erythematosus, allergic rhinitis, squamous cell carcinoma, and lupus erythematosus. The protein has been linked to immune response IL-3 activation and signaling pathway, immune response oncostatin M signaling via JAK-Stat in human cells, development thrombopoetin signaling via JAK-STAT pathway, immune response Oncostatin M signaling via MAPK in human cells, MAPK signaling, endothelin-1 signaling pathway, molecular mechanisms of cancer, antioxidant action of vitamin-C, and Rho Family GTPases pathways where it interacts with IL6ST, TNNT1, LIFR, COL4A4, and COL4A6.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: Neut, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Publications for Oncostatin M/OSM Antibody (NBP3-16686) (0)
There are no publications for Oncostatin M/OSM Antibody (NBP3-16686).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Oncostatin M/OSM Antibody (NBP3-16686) (0)
There are no reviews for Oncostatin M/OSM Antibody (NBP3-16686).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Oncostatin M/OSM Antibody (NBP3-16686) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Oncostatin M/OSM Products
Research Areas for Oncostatin M/OSM Antibody (NBP3-16686)
Find related products by research area.
|
Blogs on Oncostatin M/OSM