OMA1 Antibody

Images

 
Western Blot: OMA1 Antibody [NBP1-56970] - Lanes: Lane 1 : 10ug human fibroblast mitochondria. Lane 2: 15ug fish embryo lysate ; 6h post fertilization. Lane 3: 30ug fish embryo lysate, 6 days Primary, Antibody Dilution: ...read more
Western Blot: OMA1 Antibody [NBP1-56970] - Nuclear Lysate, Whole cell lysate, Antibody Titration: 0.2-1 ug/ml.
Western Blot: OMA1 Antibody [NBP1-56970] - Sample Type: HepG2 cells Primary Dilution: 1:1000 Secondary Antibody: anti-Rabbit TBST with 5% BSA Secondary Dilution: 1:5000 Image Submitted by: Hana Sabic University of Utah.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Fi, GP, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OMA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to OMA1 (OMA1 homolog, zinc metallopeptidase (S. cerevisiae)) The peptide sequence was selected from the middle region of OMA1. Peptide sequence WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OMA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against OMA1 and was validated on Western blot.
Publications
Read Publications using NBP1-56970.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OMA1 Antibody

  • 2010001O09Rik
  • DAB1
  • EC 3.4.24.-
  • metalloprotease related protein 1
  • Metalloprotease-related protein 1
  • MPRP1
  • MPRP-1mitochondrial
  • OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
  • overlapping activity with M-AAA protease
  • YKR087C
  • ZMPOMA1

Background

OMA1 is a mitochondrial protease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1081
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7250
Species: Hu
Applications: IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2428
Species: Hu
Applications: WB
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OMA1 Antibody (NBP1-56970)(2)

Reviews for OMA1 Antibody (NBP1-56970) (0)

There are no reviews for OMA1 Antibody (NBP1-56970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OMA1 Antibody (NBP1-56970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OMA1 Products

Array NBP1-56970

Bioinformatics Tool for OMA1 Antibody (NBP1-56970)

Discover related pathways, diseases and genes to OMA1 Antibody (NBP1-56970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OMA1 Antibody (NBP1-56970)

Discover more about diseases related to OMA1 Antibody (NBP1-56970).
 

Pathways for OMA1 Antibody (NBP1-56970)

View related products by pathway.

PTMs for OMA1 Antibody (NBP1-56970)

Learn more about PTMs related to OMA1 Antibody (NBP1-56970).

Blogs on OMA1

There are no specific blogs for OMA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OMA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OMA1
Uniprot